SKU: 36949607412

FCRL6/FcRH6 Fc Chimera Protein, Human

Sale price$525.60 Regular price$584.00
Save 10%

Pay in installments of $146.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FCRL6/FcRH6 Fc Chimera Protein, HumanProduct Specification Species Human Antigen FCRL6 RCRH6 Synonyms FCRL6, FcRH6 Accession Q6DN72 Amino Acid Sequence Leu20 Trp307, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen FCRL6/RCRH6
Synonyms FCRL6, FcRH6
Accession Q6DN72
Amino Acid Sequence

Leu20-Trp307, with C-terminal Human IgG1 Fc LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNWIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 72-80kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Da?ron M. et al. (2008) Immunoreceptor tyrosine-based inhibition motifs: a quest in the past and future. Immunol Rev. 224(1): 11-43. 2. Kulemzin S V. et al. (2011) FCRL6 receptor: expression and associated proteins.Immunol Lett. 134(2): 174-182.

Background

Members of the Fc receptor-like (FCRL1-6) gene family encode transmembrane glycoproteins that are preferentially expressed by B cells and generally repress responses via cytoplasmic tyrosine-based regulation. The FCRL gene family contained six members with FCRL1, FCRL2, FCRL3, FCRL4, FCRL5 and FCRL6. FCRL6 is located at a separate chromosomal position from the FCRL1-5 locus, has conserved synteny in mammals and is situated between the SLAMF8 and DUSP23 genes. FCRL6 gene representatives are widely present in all mammalian families, including basal mammals such as elephants, pangolins, and armadillos. It is reported that the extracellular part of FCRL molecules contains multiples numbers of Ig-like domains and their cytoplasmictail contains immunoreceptor tyrosine -based activation motifs (ITAMs) and immunoreceptor tyrosine-based inhibitory motifs (ITIMs). In humans, FCRL6 encodes a type I surface glycoprotein with three Ig-like domains, a hydrophobic transmembrane segment, and a cytoplasmic tail with two tyrosines that constitute a consensus ITIM or a non-canonical ITAM. In vitro, FcRL6 does not greatly influence NK-cell or CD8(+) T-cell-mediated cytotoxicity and has minimal impact on cytokine secretion. FCRL6 ability to recruit SHP-1, SHP-2, SHIP-1, and SHIP-2 phosphatases, and also adaptor protein Grb2 through phosphorylated cytoplasmic tyrosines.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36949607412

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
AJ
Phoenix, US
★★★★★ 3
Oily and can burn
Does make skin smooth and can help with dry skin, but that’s because it leaves an oil on the skin. It can be helped by drying with a towel. It can burn sensitive skin until rinsed. I’ve used it for a couple weeks now. Smells good, but I don’t like the oily texture it leaves and it could moisturize the skin better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2024
R
Verified Purchase
Rita C. Jones
Omaha, US
★★★★★ 5
Dead sea body scrub
Style: Grapefruit and Vanilla, Style: Grapefruit and Vanilla
An amazing body scrub. Great natural ingredients, High quality and smells amazing. I'm very pleased with my purchase. Will definitely buy it again. Highly recommend it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
M
Verified Purchase
My Rose
Omaha, US
★★★★★ 5
Great product for beautiful skin.
Smells really good lather up well, smooth application I use a mesh scrub clothes to exfoliating My skin. been using for 6 months my skin glows it's soft and i have a even skin tone. I am a subscriber never want to run out!🌹
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 8, 2025
L
Verified Purchase
L.NENROD#77
Bozeman, US
★★★★★ 5
ALL OVER BODY SCRUB GREATNESS
I really like this scrub I have sensitive skin and bearly can use different scents on it but baby my skin feels AMAZING after first I wash with dove sensitive skin bar soap then rinse and massage this into my skin starting with my elbows then my butt then my tights and legs and feet I used this 3 times a week and I love it I ordered one and it got lost before it got delivered so before cancel it I ordered another one because it said that it helps with cellulite they showed up at the same time so I kept them both I never experienced the greasy feeling I felt moisturized and soft smooth skin and I also see a little bit of a difference in my cellulite after my third shower and neither one of my lids wasn’t cracked and I love that it has a plastic seal when you twist the lid off and it has a light lemon scent I love this product I added to my shower routine now it’s one of my favorites and a must have will be purchasing more as long as it’s not discontinued or the product mix doesn’t change. Never tried it on my face.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2024
C
Verified Purchase
Christopher McMakin
New York, US
★★★★★ 5
A major upgrade from standard drugstore brands—sophisticated scent & better lather.
I have been a long-time user of standard body washes (think Old Spice, Axe, or Dove Men), but I kept seeing hype about Cremo and decided to see if it was worth the slightly higher price tag. After using the 32oz Spice & Black Vanilla for a week, I can confidently say this is a massive upgrade for your shower routine. ​Here is how it stacks up against the typical grocery store brands: ​1. The Scent is on another level: Most cheaper washes smell like generic "Sport" or "Ocean" cologne. This scent is much more complex and earthy. ​Top Notes: It starts with a sharp, spicy kick (that's the cardamom). ​Finish: It settles into a smooth, warm vanilla and tobacco scent. It smells more like a high-end department store fragrance than a soap. ​Staying Power: The scent actually lingers. If you shower in the morning, you will still catch subtle hints of the warm spices for a few hours, which pairs really well with woody colognes. ​2. Performance & Feel: The consistency is thicker than what I'm used to. You only need one solid pump to get a rich lather with a loofah. Crucially, it rinses clean without leaving that "squeaky" residue that dries out your skin, but it also doesn't leave a slick oily film like some ultra-moisturizing washes do. It hits a perfect balance. ​3. Value: The 32oz bottle is substantial. Because the gel is concentrated, I expect this bottle to last 3-4 months easily, making the cost per ounce very reasonable compared to buying smaller bottles of cheaper stuff every few weeks. ​Pros: ​Sophisticated, "grown-up" scent profile. ​High-quality pump (sturdy, doesn't clog). ​Non-drying formula is great for colder months. ​Cons: ​Potency: The scent is strong. If you are sensitive to fragrance or prefer unscented products, this might be overwhelming. The bathroom will smell like it for a good 20 minutes after you're done (which I enjoy, but keep it in mind). ​Verdict: This bridges the gap between basic hygiene and luxury grooming. If you are tired of smelling like "Blue Sport" and want something warmer and more refined for the fall/winter, this is absolutely worth the switch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2025

recommand products