SKU: 37294804685

PSMA/FOLH1 His Tag Protein, Human

Sale price$315.00 Regular price$350.00
Save 10%

Pay in installments of $87.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

PSMA/FOLH1 His Tag Protein, HumanProduct Specification Species Human Synonyms PSMA, FOLH1, NAALAD1, PSM Accession Q04609 Amino Acid Sequence Lys44 Ala750, with N terminal 10*His

Product Specification


Species Human
Synonyms PSMA, FOLH1, NAALAD1, PSM
Accession Q04609
Amino Acid Sequence

Lys44-Ala750, with N-terminal 10*His HHHHHHHHHHGGGSGGGSKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

Expression System HEK293
Molecular Weight 95-115kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Su S L. et al. (1995) Alternatively spliced variants of prostate-specific membrane antigen RNA: ratio of expression as a potential measurement of progression.Cancer Res. 55: 1441-1443.

2、O'Keefe D S. et al. (1998) Mapping, genomic organization and promoter analysis of the human prostate-specific membrane antigen gene.Biochim. Biophys. Acta 1443: 113-127.

Background

PSMA is a transmembrane protein present in all prostatic tissues. Increased PSMA expression is seen in several malignancies, although prostate cancer is the tumour where it presents higher concentrations. Almost all prostate adenocarcinomas show PSMA expression in most of lesions, primary and metastatic. Immunohistochemistry has demonstrated that the expression of PSMA increases in patients with de-differentiated, metastatic or hormone-refractory tumours. Moreover, the expression level of PSMA has a prognostic value for disease outcome.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 37294804685

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
"rhino86oo"
Carnegie, US
★★★★★ 5
My Review...
Format: Paperback
This is a great addition to the Simpsons' book family. It is just like the show, but you can spend as much time reading it as you want. I think this book is extermly fuuny. I have read pretty much every Simpsons' book and this is worth being next with them. I love how the Simpsons' comedy is different than other cartoons and even shows. The comedy is not always dark but it is not always light either. "Little Shop of Homers" was a great finisher. I wish it would of been longer, but it is OK. As with most people, one of my favorite parts in the Simpsons' comics are the in between things. For example, "Moe's Guide To Superstitions", "Bart Simpson-Master Of Disguise presents The Quick 'N' Easy, Low-Budget Do-It-Yourself Guide To COOL COSTUMES". Well, that is all I can really say. I suggest Simpson fans should read this. Keep them coming and I will keep reading.. Have A Nice LiFE! Ryan
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 12, 2000
D
Daniel
Whiting, US
★★★★★ 5
Best halloween special yet!
Format: Paperback
This is another of the many must have books for the true simpson fan. This book provides hours of laughs and would make a great gift. It has main stories, and in between shorts such as Springfield in #%*$, and a yocals guide to Halloween. I enjoy this book every time I pick it up, and you should to!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2000
O
Verified Purchase
Omar Sandoval
Bozeman, US
★★★★★ 5
Holistic Understanding
Format: Paperback
I passed my CAPM exam in December 2025. This book helped me understand how all the pieces of the puzzle fit together for the CAPM. I also supplemented with other resources, but this book helped really tie everything together. Read it all and do all the practice quizzes and tests to really get a solid understanding. I'll look for PMP related books by the same author. Very well written and easy to understand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026
A
Verified Purchase
Amazon Customer
Lexington, US
★★★★★ 5
Buy this one. It is straight to the point!
Format: Paperback
I don't usually write reviews. But this book was amazing. It was a life saver to have me refresh from my masters degree. I read domains three and four. Then I went through about 400 of the practice questions and was able to ace my exam above target in all domains. It is really easy to follow and I will be using it as a stepping stone when it is time to take the PMP exam. Definitely buy this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 21, 2025
K
Verified Purchase
Kajur
Carnegie, US
★★★★★ 4
Helped Me Pass the CAPM
Format: Paperback
You need more than this to pass the exam, but this is an excellent study guide and structure. The practice questions are way easier than the actual exam. Don't let them give you a sense of false confidence. Especially if you don't have experience. I recommend to Google project management courses, IBM, or there's another one on Udemy. Use the PMI practice exam, too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2025

recommand products