Pay in installments of $41.88 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Mouse CD90, His tagProduct Specification Species Mouse Synonyms Thy 1 membrane glycoprotein, Thy 1 antigen, Thy1 Accession P01831 Amino Acid Sequence Protein sequence (P01831, Gln20 Cys131, with C His tag) QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC Expression System HEK293 Molecular Weight Predicted MW: 14. 5 kDa Observed MW: 20 27 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C His tag
Product Specification
| Species | Mouse |
| Synonyms | Thy-1 membrane glycoprotein, Thy-1 antigen, Thy1 |
| Accession | P01831 |
| Amino Acid Sequence | Protein sequence (P01831, Gln20-Cys131, with C-His tag) QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 14.5 kDa Observed MW: 20-27 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-His tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Thy-1 or CD90 (Cluster of Differentiation 90) is a 25–37 kDa heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen. Thy-1 can be used as a marker for a variety of stem cells and for the axonal processes of mature neurons. The 162aa (murine, 161 for human) Thy1 precursor has 19 amino acid (aa 1–19) signal sequence and 31 amino acid (aa 132–162) C-terminal transmembrane domain that is present in pro form but removed when transferring the 112 amino acid (aa 20–131) mature peptide to GPI anchor which would attach through the aa 131. Thy-1 can be shed by special types of Phospholipase C e.g. PI-PLC (phosphatidyl-Inositol Phospholipase C, or PLC β). it can also be involved in cell to cell transfer of GPI anchored proteins like CD55 and CD59. It has speculated roles in cell-cell and cell-matrix interactions, with implication in neurite outgrowth, nerve regeneration, apoptosis, metastasis, inflammation, and fibrosis. It has also been proven to be a tumor suppressor for some tumors. In case of prostate cancer it has been shown to be expressed in cancer associated stroma but not in normal stroma and has been suggested to be of potential help for cancer specific drug targeting.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy