SKU: 39282079346

BCMA/TNFRSF17 His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

BCMA/TNFRSF17 His Tag Protein, HumanProduct Specification Species Human Antigen BCMA TNFRSF17 Accession Q02223 1 Amino Acid Sequence Met1 Ala54, with C terminal 8*His MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHH Expression System HEK293 Molecular Weight 15 19kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution Reconstitute at 0. 1 1 mg ml

Product Specification


Species Human
Antigen BCMA/TNFRSF17
Accession Q02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal 8*His MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

15-19kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39282079346

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
lea
Battle Creek, US
★★★★★ 4
unnoticeable and sticky
they're thin enough that they don't get noticed but they stick very well and are easy to use. they stuck VERY WELL and worked WONDERS FOR ME
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2024
T
Verified Purchase
TofuTofuTofu
Boise, US
★★★★★ 5
This is innovation
I occasionally get pimples that seem like asteroids hit my face and landed. I used to have those "cutting" patches to cover up for these large pimples but this product really saves the time wasted for cutting a size perfect for your asteroid. The biggest size was just enough to cover a large pimple I had recently (I would say the pimple was like 8~9mm measuring the longest size) and it did fine pulling out the sebum. Of course it wouldn't fit and stay on as a customized cut patch, but it definitely has the adhesion to do the job. The huge pimple was gone in around 2 days.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 27, 2024
I
Verified Purchase
Imaphatsharkie
Lake Worth, US
★★★★★ 5
Love then... They work like a charm...
I have sensitive skin. These works like a charm. Definitely recommend for anyone whose skin is acne prone. I also uses these to help cover small deep cuts that liquid bandages are not able to quickly treat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 31, 2025
B
Verified Purchase
Blu Sonora
Charlottesville, US
★★★★★ 5
Best brand
Out of all the acne patches I’ve used, this is by far the best brand. I’m really acne prone &’ as soon as I turned 22 my skin just decided it’s time to break out again lol. I went through everything to dermatologist, new products, &’ even tried other acne patches that would essentially just turn my pimples into scars. I vouch for this brand of your acne and scar prone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2025
E
Verified Purchase
Emily
Birmingham, US
★★★★★ 4
Get the job done & adhere well
I ordered these by mistake once when trying to order more of the normal sized and mini ones from this brand. I love their other patches and thought these would be great to have on hand too. Sometimes I feel like these don’t seem as effective as the typical 12mm patches from most brands regardless of the type of blemish I put it on. But I think they get the job done. They definitely stay on, but I prefer patches with the visible circle in the middle and transparent edges. These are nearly invisible and smooth though so easy to cover with makeup if needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2023

recommand products