SKU: 39686759212

CD3 delta His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD3 delta His Tag Protein, HumanProduct Specification Species Human Synonyms T3D, CD3 DELTA, CD3D Accession P04234 Amino Acid Sequence Phe22 Ala105, with C terminal 8*His FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAHHHHHHHH Expression System HEK293 Molecular Weight 17 30kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution

Product Specification


Species Human
Synonyms T3D, CD3-DELTA, CD3D
Accession P04234
Amino Acid Sequence

Phe22-Ala105, with C-terminal 8*His

FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAHHHHHHHH

Expression System HEK293
Molecular Weight 17-30kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

T-cell surface glycoprotein CD3 delta chain, also known as CD3D, is a single-pass type I membrane protein. CD3 delta/CD3d is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T cells. CD3 delta/CD3d contains an 84 amino acid extracellular domain, a 21 amino acid transmembrane domain, and a 45 amino acid cytoplasmic domain. Deleterious mutation of the CD3 delta encoding gene in the human leads to a severe combined immunodeficiency characterised by the complete absence of mature T cell subpopulations including TCR alpha/beta and TCR gamma/delta. In humans the absence of CD3 delta results in a complete arrest in thymocyte development at the stage of double negative to double positive transition and the development of gamma delta T-cell receptor-positive T cells is also impaired. CD3D, together with CD3 epsilon (CD3E), CD3 gamma and CD3 zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T cell receptor-CD3 complex. T cell receptor-CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39686759212

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Twerkjerky
Houston, US
★★★★★ 5
Smells great
Scent: Casked Vanilla
The best
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
B
Verified Purchase
BOBBY
New York, US
★★★★★ 5
Review
Scent: Casked Vanilla
I really like Cremo body wash. They have so many different scents. I have 5 of them. Choose the scent that best fits u..
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
R
Verified Purchase
Randy woodall
Belleville, US
★★★★★ 5
Choose your smell
Scent: Casked Vanilla, Scent: Casked Vanilla
It is very good body wash. I tried the Fragrance. It’s ok but I like the golden Amber much better. I also like the shampoo and conditioner
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
C
Verified Purchase
Colvinson Valeus
Lake Worth, US
★★★★★ 5
One of the best
Scent: Bourbon Oak
One of my go to and you won't regret it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
D
Verified Purchase
Deebz
Los Angeles, US
★★★★★ 5
• Create a signature fragrance for a foaming dispenser
Scent: Palo Santo, Size: 16 Fl Oz (Pack of 2), Scent: Palo Santo, Size: 16 Fl Oz (Pack of 2)
One of the features that I enjoy about liquid soap is its ability to quickly refresh skin. This Palo Santo product is certainly one of the most unique offerings on the market; it is warm and pleasant, albeit a short-lasting fragrance as should be expected of any body wash. While most customers will consider using this product exclusively as a body wash, my preference is to enjoy it throughout the day as a hand and face refreshment. Use a foaming soap dispenser This product can be used as a daily hand and facial wash. Now, you might be thinking that this would be pretty inconvenient because the product is contained in a talI bottle with a flip-up top that can be both clumsy to use and takes up counter space. To address these problems, transfer the product into a small, foaming pump, counter top dispenser. Now I know what you’re thinking; how is this possible? This product has a viscosity similar to syrup. It will never pass through a foaming dispenser. And you would be correct in that critique; so don’t use it straight-up from the Cremo bottle. Instead, dilute the product with water. Since I’ve used this method before with other liquid soap products, I know that it will work consistently by following a few simple steps. The goal is to make a diluted solution of at least 90% warm water and 10% product, in other words a 9-to-1 dilution. Using a smaller ratio with too much product will likely jam the pumping mechanism because the product is too viscous to transit the foaming mechanism. How would this be done? Step 1. Select an empty foaming soap dispenser. The brand is not as important as long as you are able to fill it with water and soap product. Step 2. Fill the dispenser with warm water to reach about three inches from the top of the bottle. Step 3. Pour in Palo Santo to raise the water level to about one inch above the existing water line. Step 4. Cover the top of the dispenser with your palm and gently mix the product and water by rocking the bottle, or stir the product until it mixes with the water. I don’t recommend shaking the bottle. Shaking will result in a lot of soapy lather escaping the container before the pump top is reattached. Note: When filling the container, leave enough air space at the top of the dispenser for the stem and pump mechanism to be returned to the container. Overfilling just means that some product will escape when recapped. Step 5. After the top is reattached, prime the pump a few times and the foam mixture should smoothly leave the bottle. Photo One shows the water and Palo Santo mixture. As you can see, the mixture is transparent. The result is an easy to use hand and face foam wash. This pump spray approach means that the Cremo bottle can be stored away until a refill is needed. This process should work for every clear Cremo product. Create your signature fragrance The Palo Santo fragrance is unique, but its colorless appearance in a dispenser is not inviting. The product could use some color to make it more appealing and some zhoosh fragrance from another product. To accomplish this, add an extra body wash product that is both colorful and has a complementary fragrance to the original Palo Santo. All it takes is this addition to Step 3: Step 3-PLUS. Add about a quarter inch of another liquid soap to the container and mix it as in Step 4. The result is now a colorful mixture with a more expressive fragrance. Three different combinations In my first trial, Palo Santo was mixed with sage and cedar wood that added an attractive teal color (see photo 2). In the second trial Palo Santo was mixed with mint and rosemary making a blue combo (see photo 3). The third trial was a mixture of coconut and black pepper creating a purple mixture (see photo 4). Each of these combinations produced a complex blend of fragrances that would appeal to family and friends. Blend Palo Santo to your personal taste Palo Santo has a reputation for being a “mature” fragrance. Fair enough. But it does need to be—like Old Spice(y) or Hai Karate. Instead, it can be developed into a more chic and modern choice. By adding a dash of extra ingredients, you can design a blended Palo Santo fragrance that is both more complex and appealing. Certainly, with a little experimentation, you can also create a variety of mixtures that enhance Palo Santo and broaden the spectrum of your daily hand and face wash products. Just start with your favorite Cremo product and zhoosh-it-up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 7, 2023

recommand products