SKU: 39690486587

CTLA-4 His Tag Protein, Human

Sale price$94.50 Regular price$105.00
Save 10%

Pay in installments of $26.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CTLA-4 His Tag Protein, HumanProduct Specification Species Human Synonyms Cytotoxic T lymphocyte associated protein 4 Accession P16410 Amino Acid Sequence Ala37 Phe162, with C terminal 10*His AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 20 27kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms Cytotoxic T-lymphocyte-associated protein 4
Accession P16410
Amino Acid Sequence Ala37 - Phe162, with C-terminal 10*His AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 20-27kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80 and CD86, are typically found on the surface of antigen-presenting cells and can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts its inhibitory function can be categorized as either cell-intrinsic (affects the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells). CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28, CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic effects on the interacting cell.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39690486587

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Carmen Dolores Ramos
Phoenix, US
★★★★★ 5
Ivory Modern Essentials Dinnerware Set
These white ceramic dinnerware pieces have a clean, modern, and minimalist design that works well for both everyday meals and casual entertaining. The glossy finish gives them an elegant look, while the neutral white color easily matches different table settings and kitchen styles. The mugs appear sturdy with comfortable handles, and the plates have a simple yet timeless shape that feels versatile for a variety of dishes. One of the standout features is their practicality. The smooth ceramic surface looks easy to clean, and the stackable plate design helps save storage space. The set also feels durable enough for daily use while still looking refined enough for guests. Overall, this dinnerware set offers a great balance of style, simplicity, and functionality. It’s an excellent option for anyone looking for affordable, classic tableware that can fit seamlessly into almost any home décor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
I
Verified Purchase
Ian Simon
Grantham, US
★★★★★ 5
Exceptional quality!
I have had these dishes for two years and highly recommend them. For the price, it is unbeatable. These have the benefits of significantly higher priced dishes. They are a solid weight, which is an important factor in preventing them from being too hot to touch after microwaving. When filled with freshly brewed coffee, the mugs can be on the verge of being too hot to touch, but there is no issue if holding from the handles. I have a fireclay sink that could cause issues with weaker dishes. The handles on the coffee mugs have proven durable over time. I have never experienced a crack in the mugs, even where the handles meet the mugs. I have dropped dishes over time. These do not splinter or shatter into tiny pieces like comparably priced dishes. These crack into large pieces. I have endured chips and cracks in a bowl and plate. Neither broke apart further, despite hot or cold temperatures from microwave, dishwasher, or ice cream. I have not experienced any staining over time. The dishes clean very well in the dishwasher. The minimalist style, weight, and functionality of these dishes compare to sets that cost significantly more money at luxury brand stores.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 9, 2024
R
Verified Purchase
ronnie white
Grantham, US
★★★★★ 5
Good design and size.
I was surprised at the quality. of this dish set. The cups were well balanced and delightful to use. The bowls are of good shape and just the right size for a bowl of cereal or soup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
D
Verified Purchase
David White
Lake Worth, US
★★★★★ 4
Minimalist, imperfect but certainly reasonably good for the price
This is a set of 16 pieces, all of which are usable and practically sized, including the coffee/tea/beverage cups. While this is absolutely not high quality it is more than expected for $30 or so. The dishes are on the heavier side, not very lightweight brittle. I doubt they are break resistant. While they appear bone white, which they are, I'm not sure they are pure white (almost.) Some dishes will feature some small imperfections, like a small dot here and there, nothing too terrible. Stacking them is where you'll notice that the large plates are absolutely not perfect and you'll see that the ends are not perfect by rotating the plates and you'll notice areas they go slightly up and down. Again, nothing really noticeable or terrible unless you stack them. If you've got a dorm room, don't care too much about having anything more than a minimalist set of reasonable quality dishes that you won't get embarrassed about for serving casual meals, this makes for a decent set. Hopefully they are safe (supposedly Amazon says they are) and they are made in China. If you're wondering about branding, on the bottom of each item there is a conspicuous amazon basics logo.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2018
K
Verified Purchase
Kindle Customer
Bozeman, US
★★★★★ 5
Great starter set
They are very nice. Great starter set. They don’t feel cheap. The only issue I have is that the bowls are small. That is only picture I took.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products