SKU: 39699383268

Human TL1A/TNFSF15 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TL1A/TNFSF15 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI Accession O95150 Amino Acid Sequence Protein sequence (O95150, Leu72 Leu251, with C His tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Product Specification


Species Human
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI
Accession O95150
Amino Acid Sequence

Protein sequence (O95150, Leu72-Leu251, with C-His tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.2 kDa Observed MW: 22, 25, 28 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39699383268

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Hawaiian
Charlottesville, US
★★★★★ 4
Great shoes that are well made, lite weight, and comfortable.
Size: 12, Color: Brown
Just received my 2nd pair of shoes from Bruno Marc in a size 12. These are really lite and comfortable. It can be dressed down to be a casual shoe or dressed up with a nice suit. These run true to size so I ordered my usual size 12 and the fit was perfect. Being my 2nd pair of Bruno Marc's, I like the quality of their shoes and each shoe is described appropriately on fit and comfort. Insole of these shoes were awesome and provided soft comfort on the feet along with a slight arch support too. Will definitely consider ordering more Bruno Marc shoes in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2025
J
Verified Purchase
JCMIV63
Houston, US
★★★★★ 5
Cushioned, comfortable, stylish and a rubber sole!
Size: 10, Color: Brown
These shoes check multiple boxes for me, comfortable, cushioned, rubber sole and stylish. As my feet grow old and worn out, I'm on a constant search for comfortable, cushioned shoes that are suitable for work and dressier occasions. I have tried many expensive shoes that look great but either lack cushioning, arch support and or comfort. One of the nice things is these shoes have a rubber sole, where most cushioned shoes have the foam soles which are great, but they tend to lack grip particularly when its damp/wet. They have average arch support, but the insole is removable and I put my own cushioned arch support. Love these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
D
Verified Purchase
DDD Projects
Massapequa, US
★★★★★ 5
OG Style
I am a big fan of Bruno Marc shoes. Over the years they have provided comfortable and affordable boots and shoes. These blue, tan and white soled dress sneakers are no exception. They have a nice finished look that makes them both causal and dressy. The lightweight style is still warm enough for colder mid-west winters. The box of the toes is wide and comfortable. The insole is well padded and a pleasure to wear. This is another fine pair of shoes to add to my collection and yours.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
P
Verified Purchase
Premium Reviews
Lexington, US
★★★★★ 5
Must buy: Comfort + Casual + Well Made / Ventilated
Size: 8, Color: Brown
Just buy it! I have put in roughly 15,000 steps in this shoes in 10 days and I can't believe how comfortable they are after this much rough use in short amount of time. I highly recommend this shoes to anyone looking for comfort in casual style.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
W
Verified Purchase
William W.
New York, US
★★★★★ 5
WIDE Dress Shoes With SUPPORT
Size: 10.5, Color: Brown
I've seen dress shoes and worn dress shoes before, but these are simply the best dress shoes I've ever worn my entire life. 99% of dress shoes have the same problem, they have the thinnest little soles that offer no support. BRUNO MARC HAS SOLVED THE PROBLEM. These dress shoes not only support wide feet like mine who historically have had and still have little support in the market, but Bruno Marc has wide options that fit perfectly, and the support with the thick foam sole is so needed and awesome. I had a pleasant surprise putting these things on and there being some tactile grip enhancers inside the shoe so you can feel the shoes better and get a little tickle / massage while you're at it. These things are dripping with style, easy to wear, and while they might look firm on the outside, on the inside the shoe just has such a nice flexibility and foamy feel, the top where the top of your feet feel the roof of the shoe, it has such perfect ooey gooey support I can't believe it. The outside sole also has this neat tactile feel. The durability looks good and feels good for now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 28, 2025

recommand products