Pay in installments of $56.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 22 - Jul 27
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP8 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 8, P2, PMP2 Accession P02689 Amino Acid Sequence Ser2 Val132, with N terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Expression System E. coli Molecular Weight 18kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | Fatty acid binding protein 8, P2, PMP2 |
| Accession | P02689 |
| Amino Acid Sequence | Ser2-Val132, with N-terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV |
| Expression System | E.coli |
| Molecular Weight | 18kDa (Reducing) |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP8 (fatty acid binding protein-8; also M [myelin]-FABP, P2 and PMP2) is also known as peripheral myelin protein 2, which is a cytosolic protein found primarily in peripheral nerves. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. Also, PMP2 may play a role in lipid transport protein in Schwann cells. Furthermore, PMP2 may bind cholesterol. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin, which is a cytosolic protein found primarily in peripheral nerves.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 24 reviews
Sort
Product Reviews
★★★★★ 5
Two Filters, Quick and Easy
Size: 16-23 Tacoma, Size: 16-23 Tacoma
The RVgolf Engine+Cabin Air Filters Kit for the Toyota Tacoma V6 comes with two air filters. There is a cabin air filter that fits nicely into the compartment accessed through the glove box and an engine air filter that dropped in easily in the compartment under the hood.
Replacement of both filters was easy, didn’t require any tools, and it took more time to empty and replace the items in the glove box than it did to replace both filters.
The Toyota dealership quoted me $80 to replace the cabin air filter only. I replaced both filters for less than $30.
The filters felt like they were good quality. The engine air filter is multi-layered, with a thin foam layer to keep larger debris from blocking the finer paper filter. The cabin air filter said and looked like it had a carbon layer to absorb smells. The only concern I had was size. After I had replaced both filters I went to slide the engine air filter I replaced into the RVgolf box to throw it away. The engine air filter I replaced would not slide into the RVgolf box. It was too big.
After driving for a few days and a couple of hundred miles, I popped the hood and checked the fit of the engine air filter. The fit looked perfect. See attached photos.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
★★★★★ 5
Fits 2019 accord (gas engine)
Size: 18-22 Accord
Dealer was going to charge almost $200 to change both of these filters in my 2019 accord. These filters fit perfectly and of same quality as the dealer product. Easy to install, saving me lots of money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
★★★★★ 5
Great quality and Easy to install
Size: 18-22 Accord
As someone with zero experience changing air filters, I was honestly surprised at how easy this was. The fit was perfect for my 2010 Honda Accord Sport, and both the cabin and engine air filters installed with no issues at all. It even came with clear, easy-to-follow instructions that made the whole process stress-free. Saved myself money from going to the dealership, and my car is running great. Definitely recommend for beginners wanting to do a simple DIY maintenance job.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
★★★★★ 5
Great Product Great Price
Size: 16-21 Civic, 17-22 CR-V
product was a good priced. Fit as it should. will buy again when needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
★★★★★ 5
Air filters are great
Size: 10-24 4RUNNER, 10-23 GX460
I received when promised and it fit my automobile correctly, I get good gas mileage already so we will see if the gas mileage comes up. The quality was great always looking for high quality when changing the air filters and this item met that standard. Go ahead and buy it will meet you demands.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
recommand products
Handwoven Leather Accent Pillow
95.00
King Protea Isolated On Black Background Centre - A Colorful Flower With A Blue Center
19.95
Icebergs At Night Jokulsarlon Lagoon Iceland - A Colorful Sky With Clouds And Trees
19.95
Malaysia Village In Watercolor Painting - A Watercolor Of A River With Houses And Trees
20.55
Mango Mimosa Cocktail - A Painting Of Two Glasses Of Orange Juice Next To Oranges
20.55