SKU: 41691599076

Human CD1D Protein, His tag

Sale price$157.50 Regular price$175.00
Save 10%

Pay in installments of $43.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD1D Protein, His tagProduct Specification Species Human Synonyms Antigen presenting glycoprotein CD1d, R3G1, CD1d Accession P15813 Amino Acid Sequence Protein sequence (P15813, Val21 Gly296, with C His tag)

Product Specification


Species Human
Synonyms Antigen-presenting glycoprotein CD1d, R3G1, CD1d
Accession P15813
Amino Acid Sequence

Protein sequence (P15813, Val21-Gly296, with C-His tag) VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWG

Expression System HEK293
Molecular Weight

Predicted MW: 33 kDa Observed MW: 43-55 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD1D is a non-classical MHC class I-like glycoprotein specializing in lipid antigen presentation to T cells, particularly natural killer T (NKT) cells. Unlike classical MHC molecules, it presents lipid and glycolipid antigens via a unique binding groove. Expressed on antigen-presenting cells, CD1D bridges innate and adaptive immunity by activating NKT cells to secrete cytokines, influencing responses to infections, autoimmunity, and cancer. Genetic variants are associated with diseases like type 1 diabetes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 41691599076

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jonathan
Fort Morgan, US
★★★★★ 5
Believe the Reviews
Color: Cooling Blue Cover, Size: King (Pack of 2)
I purchased these pillows because we were in need of new pillows, I previously had allswell pillows which were from walmart and they were good to start but now they tragically became very sparse and it started to effect my sleep so I saw these after careful review on other pillows and reviews I came across these and I saw some reviews and videos and I ordered them.. first they are king size we ordered they are perfect for the bed, they are plump and soft, they are memory foam which has always worked out for me for support and kept it’s shape these are great it did have a little smell I guess from packaging but other than that they are a huge upgrade from what we had before! I’m excited because they are cooling too! for the price point can’t beat it and this is coming from someone who was about to spend money on a purple pillow this will be good for now definitely buy it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
P
Verified Purchase
PilarC
Lexington, US
★★★★★ 3
Inconsistent
Color: Cooling Blue Cover, Size: Queen (Pack of 2)
Ive ordered two different batches of these pillows, the first was a 2 pack, the second batch was a 4 pack. The pillows that came in the 2 pack have a different quality to them. The memory foam feels thicker, takes long to depress and to spring back to form. It offers more resistance, a heavier odor (at the start), and was the pillow that I fell in love with. Things changed when I ordered the 4 pack a couple months later. There was an inconsistency between the foam in these two different batches. both sets of pillows are comfortable. The first batch being firmer means I had to remove more foam before it became comfortable but the 2nd batch being more springy, I was able to keep all the foam inside. I docked a couple stars because I’m not able to provide a consistent experience with these pillows across all three beds in my home. If you need a pillow, order a set and be happy. If you want a bunch of memory foam pillows throughout your house, maybe look elsewhere as these may not all be identical.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2026
M
Verified Purchase
Mari
Lexington, US
★★★★★ 5
Very cool and comfortable pillows. Great value.
Color: Cooling Blue Cover, Size: Queen (Pack of 2)
These pillows are everything described on the site. They do retain shape and don’t flatten out after sleeping all night. They are nice and clean looking and comfortable. The fit on my king size bed is perfect cause I prefer the size to king size. Haven’t had to wash them yet but I have had other pillows with the same material inside and the wash ability is great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
J
Verified Purchase
Joe
Waukegan, US
★★★★★ 5
Great pillow
Color: Cooling Blue Cover, Size: Queen (Pack of 2)
The pillows feel great. Being able to remove portions of the interior allowed me and my wife to have a perfect fit. They do stay cool which seems to have helped with my restlessness.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
C
Verified Purchase
Charlie
Port Orchard, US
★★★★★ 5
This Pillow Is A Must Buy!! What Are You Waiting For?
Size: Queen (Pack of 1)
This is, without a doubt, the best pillow I have ever owned. One of my favorite features is the adjustable shredded memory foam fill, which allows you to customize the loft and firmness by adding or removing foam to suit your sleeping preferences. As both a side and back sleeper, I found it incredibly comfortable and supportive. The overall quality is excellent, from the materials used in the pillow itself to the thoughtful packaging. The removable cover is washable, although I personally use a pillowcase to keep it protected. I also appreciated that extra foam is included, making it easy to fine-tune the pillow over time. The difference in my sleep quality was noticeable from the very first night. I’ve been sleeping more comfortably and waking up feeling more rested ever since I started using it. Considering the quality, comfort, and customization options, I believe the $75 price point is well worth it. I am so impressed with this pillow that I plan to purchase another one in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026

recommand products