Pay in installments of $37.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 10 - Aug 15
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
H5N1 HA (A/Hong Kong/483/97) His TagProduct Specification Species H5N1 Antigen HA Hemagglutinin Synonyms Hemagglutinin, HA Accession O92930 Amino Acid Sequence Ser405 Val520, with N terminal 8*His HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV Expression System HEK293 Molecular Weight 72 80 43 55 25 30kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | H5N1 |
| Antigen | HA/Hemagglutinin |
| Synonyms | Hemagglutinin, HA |
| Accession | O92930 |
| Amino Acid Sequence |
Ser405-Val520, with N-terminal 8*His HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
|
| Expression System | HEK293 |
| Molecular Weight | 72-80 43-55 25-30kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles. |
| Reference |
1.Michal Lazniewski, M. et al. (2018) Briefings inFunctional Genomics 17:415. 2. Sriwilaijaroen, N. and Suzuki, Y. (2012) Proc. Jpn. Acad. Ser. B. Phys.Biol Sci. 88:226. 3. Chang, Y.J. et al. (2021) Sci Rep 11:8637. |
Background
Neuraminidase (NA) and hemagglutinin (HA) are major membrane glycoproteins found on the surface of influenza virus. Hemagglutinin binds to the sialic acid-containing receptors on the surface of host cells during initial infection and at the end of an infectious cycle. Hemagglutinin also plays a major role in the determination of host range restriction and virulence. As a class I viral fusion protein, hemagglutinin is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization either through clathrin-dependent endocytosis or through clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy