SKU: 42383434713

Mouse VEGF-A Protein, His Tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse VEGF-A Protein, His TagProduct Specification Species Mouse Synonyms VEGF164, Vascular permeability factor (VPF), VEGF 1, VEGF164 Accession Q00731 2 Amino Acid Sequence Protein sequence (Q00731 2, Ala27 Arg190, with N His tag) APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Expression System HEK293 Molecular Weight Predicted MW: 21 kDa Observed MW: 25 30 kDa

Product Specification


Species Mouse
Synonyms VEGF164, Vascular permeability factor (VPF), VEGF-1, VEGF164
Accession Q00731-2
Amino Acid Sequence

Protein sequence (Q00731-2, Ala27-Arg190, with N-His tag) APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Expression System HEK293
Molecular Weight Predicted MW: 21 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

VEGFA is a key signaling protein that stimulates angiogenesis (blood vessel formation) and vascular permeability. Produced by various cell types, it binds to receptors VEGFR-1 and VEGFR-2, promoting endothelial cell proliferation, migration, and survival. Overexpressed in tumors, VEGFA supports cancer growth and metastasis by enhancing blood supply. It is a major target in anti-angiogenic cancer therapies, with drugs like bevacizumab (Avastin) blocking its activity. VEGFA also plays critical roles in wound healing and inflammatory diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 42383434713

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bryan Desmond
San Leandro, US
★★★★★ 5
God created Arrakis to train the faithful.
Format: Kindle
Being as long as it has been since I've last read Dune, eight or nine years or so, I had a small worry that my extremely high opinion of the book was at least slightly inflated by time's passage and fond memory. The first chapter alone was enough to dissuade me of that. I sit here now, having just finished, with full confirmation that Dune remains on the throne my thirteen-year-old self set it upon; that of my favorite book. Herbert's writing is sharp, his ideas are powerful, and he is willing to dive deep immediately. He asks much of the reader, providing a glossary and gently insisting we keep up. Those types of stories are the most rewarding, I've found. Forgive me but most of this review, all of it perhaps, will be unfiltered praise. This book means a lot to me; it has for a long time. And revisiting it, in light of all the exciting movie news with Denis Villeneuve, was more than a treat. I will refrain from summarizing the story; it's likely you know what it's about. If not, Goodreads has neatly summarized it better than I will. The book, and the prose in general, holds up extremely well for having been written over fifty years ago. Admittedly the character thoughts and some dialogue is a little stiff in areas. But not so much so that it hindered my enjoyment in any way. Additionally I'm not used to omniscient narration; you just don't see it that often currently. I don't at least. So the POV hopping without chapter or line breaks took just a little getting used to. Having said that, I am so impressed by Herbert's expertise at moving his story using the art of conversation, and all its minutiae. This is especially true when Fremen are in conversation with non-natives, and the culture clash is on display. If you hold it in your hand, what you hold is more than a mere science fiction novel. It breaks through those boundaries as a worm broaching the desert surface. This is a space-fantasy, and a heady mixture. The story is wrapped up as much in mysticism and religion as it is in technology; more so even. It is as concerned with ecological prediction and deep, flowing political undercurrents as it is with a well-written fight scene. It is the perfect mixture of odd-future strangeness, vast cosmic scope, and spiritual involvement that stitches the story up at the seams. Prophecy, and psychedelic consciousness-expansion through the addictive spice melange, are as much the heart of this story as laser guns and space ships. So much so that one wonders just how many mushrooms Frank Herbert was eating as he penned this thing in the 1960's. And I'm only kind of kidding. Herbert, with this first story alone, never mind the sequels, displays an absolute mastery of world-building. He has just the right flavors of real-world inspiration and influence to make it all feel familiar; especially in the touches of Eastern influence, down to the broken remnants of Sanskrit appearing in the Fremen language. It all just feels so feasible. Like you're at once reading a manual of our distant future and texts of our ancient past. Meeting in the now. That ethereal, dream-like moment of present time. The now. It's clear I've been infected by the mood of the story. And beyond anything else, the story is itself is just so interesting. I found it hard to put down even for a moment. Even the epigraphs are worth a session of deep thought, and clearly lead the way for popular usage in things like Sanderson's Cosmere stories. Dune influenced so much that followed it it's just undeniable. I can't help but draw parallels with the Wheel of Time, which I'm in the middle of. I drew comparisons with the Aiel/Fremen immediately when I started reading WoT, and that comparison is reinforced. As are other little things that hint at direct homage (Shaitan being the name for Satan in Dune, for example). I remember, all those years ago in Frogtown Books, the quote on the back that caught my eye. 'I know nothing comparable to it except the Lord of the Rings.' What higher praise? Here is a book that transformed the landscape of science fiction; just as it transformed, for me, what fiction can be. Something like Dune is extremely hard to review for me, so forgive my love affair in the form of language. I just can't say enough good things. Dune shaped my reading life growing up, and now I remember why. I can do nothing more but urge you to read it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2019
J
Verified Purchase
J. Lee
Whiting, US
★★★★★ 5
A must read epic that leaves you hanging a bit
Format: Kindle
Right off the bat, this is one of the most enjoyable and thought provoking books I’ve ever read. I’ve always struggled with books this long, but this book was such a page turner that I looked forward to getting back to it night after night for about 10 days. Two very different types of work, but the only time I’ve ever felt like this about a book of this magnitude in volume was with the lengthier Harry Potter books. Despite all the made up terms that Mr. Herbert created to delineate this massive interplanetary world, which can be a bit confusing in the beginning, you’re sucked into the vortex that is Dune from 1st chapter. Some of the most enjoyable aspects of this book for me were constant flow of inner perspectives from one character to another in beautiful prose, timeless characterization of human society, religion, politics, technology, etc., and the sheer scale of this universe which goes much beyond the planet of Arrakis where the majority of this 1st book takes place. From the beginning, the reader gets very much invested into the main character of Paul Atreides. Early scenes make you excited about the potential of his power and influence, you ride along with early trials and tribulations that include massive loss of loved ones, and you see the ascension of his power and stature from the lowliest of place. But things aren’t all rosy, along the way, you see the boy becoming a man while giving up his innocence. The sense of righteousness and compassion for people that he’s held so dearly seem to fade in the process as he wades his way through the realization of his extraordinary power, though you don’t really see how those inner transgressions manifest themselves down the road. On a related note, the sole downfall of this book for me is the abruptness of the ending. Up until the very end, you’re treated with a barrage of character and story development, but Mr. Herbert throws a changeup at the end with a very economic conclusion to the story. You’re left hanging wondering what in the world the ending means for the plethora of characters you’ve become invested in. You wonder whether Paul will walk in the light, or in the darkness in his new position. I don’t know whether this was done intentionally to introduce a sense of comic irony, or whether a sense of cliffhanger was placed to get people to read the subsequent books. If the latter was the case, I must admit my disappointment. This was such an amazing book for me until the end. The subsequent books should’ve been recognized on their own merit, and not rely on the momentum of this first book. But I could be wrong, I’m just a casual reader, and perhaps this sort of ending is a pure touch of genius to the experts. But as a casual reader, I felt left hanging, grasping for something that’ll never be fulfilled….like life (and perhaps that was the author’s point too).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 7, 2020
A
Verified Purchase
AMZN Ace
Chelsea, US
★★★★★ 5
Considered to be the best science fiction novel ever written.
Format: Mass Market Paperback
This book is often considered to be the best science fiction novel ever written and for good reason. _Dune_ is a 1960s-era science fiction novel, published on the cusp of the Golden Age and the New Wave. Science Fiction of the time was in a transitional period influenced by the periodical _Galaxy_. SF at the time emphasized what some would call soft science fiction, a genre dealing with psychology, sociology, and sociopolitical commentary, with the bonus of one or more unique original ideas and a Sense of Wonder. Within these domains, _Dune_ hits every note a book of its genre could possibly hit and does so brilliantly. This is not anything like what passes for science fiction today, as the genre has been heavily-influenced by the Modernist movement and is now characterized by meandering fiction with long atmospheric narrative descriptions and no idea content other than politically-correct gender diversity, as is often found in a Gardner Dozois Year's Best anthology. This novel seems more nuanced and cogent to me today as an adult than it did when I first read it as a teen. The explorations of preternatural consciousness, mind control, economics, religion, and political intrigue are fascinating. But _Dune_ was also revolutionary in its use of what was then called Ecology (now called Environmental Science) as a hard science. This book is a high mark in the achievement of hard-science worldbuilding. After all these years it is still the most well-thought out and well-fleshed out worldview in the entire SF canon. Its complex, logical worldbuilding is presented in what was the then-prominent Science Fiction protocol of revealing the world little by little through contextual clues rather than inserting infodumps of description. As such it takes more work to read than a more modern book with infodumps. Readers who find the book boring aren't reading it with Science Fiction reading protocols and apparently most of them are too callow to resonate with some the book's political, economic, and sociocultural commentary. The genre was about ideas, not literary modernism, so you will not find the book filled with metaphors and literary allusions such as one might find in a Creative Writing MFA's workshopped short story, although Paul's story is clearly the Hero's Journey and he is obviously a Messiah figure as well as a military/political leader. The characters may not be as well-rounded as in a Dostoevsky novel but in case you missed it, the main character isn't really Paul. The main character is the planet Arrakis. Read this book with that in mind and you'll be amazed. For those expecting a Hollywood superhero comic-book style movie with action scenes and high-definition special effects, there is some of that in here too, but that is not the main point. This is a Frank Herbert novel of ideas, not a David Lynch film of striking visuals.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2018
K
Verified Purchase
Karen M
Boise, US
★★★★★ 5
Good to use every night...I do.
If you suffer from dry mouth during the night, these are the perfect solution. I had tried rinses - they don't last. Sprays - they don't last. lozenges - don't last. Other tablets, only last a few hours. I can get about 8 hours relief with these. Contrary to other reviews, you do not suck on them like a lozenge...they won't last at all if you do it that way. Read the directions. They "adhere" to your back molars...don't drink or eat after putting them in...as both will either dislodge or reduce the effectiveness. However, when I don't use these, my mouth is miserable and so dry. These provide enough moisture throughout the night. The flavors aren't too bad. I've used the mint (not may favorite because I'm not a fan of mint flavor), orange and berry. I wish they had other flavors (cinnamon, licorice), but till then, I'll use these probably forever.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2026
B
Verified Purchase
Brenda P
Fort Morgan, US
★★★★★ 5
Really helpful for dry mouth.
Scent Name: Berry, Size: 100 Count
These really work. I wear a CPAP and my mouth was so dry I was waking up with my tongue stuck to the roof of my mouth. They stick well so no worry of swallowing it during the night. I like the berry flavor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026

recommand products