SKU: 43227985175

VSIG3/IGSF11 Fc Chimera Protein, Human

Sale price$259.20 Regular price$288.00
Save 10%

Pay in installments of $72.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VSIG3/IGSF11 Fc Chimera Protein, HumanProduct Specification Species Human Antigen VSIG3 IGSF11 Synonyms VSIG3, IgSF11, CXADRL1, Bt IgSF, CT119 Accession Q5DX21 1 Amino Acid Sequence Leu23 Gly241, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen VSIG3/IGSF11
Synonyms VSIG3, IgSF11, CXADRL1, Bt-IgSF, CT119
Accession Q5DX21-1
Amino Acid Sequence

Leu23-Gly241, with C-terminal Human IgG1 Fc

LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

55-70kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Suzu S, Hayashi Y, Harumi T, Nomaguchi K, Yamada M, Hayasawa H, et al. Molecular cloning of a novel immunoglobulin superfamily gene preferentially expressed by brain and testis. Biochem Biophys Res Commun (2002) 296(5):1215–21.

Background

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43227985175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tiff
Massapequa, US
★★★★★ 5
Ben Solo’s fall is tragic
Format: Paperback
We don’t know much about Ben Solo’s past, but this comic explains a little bit more about why he is the way he is. It also explains that he didn’t do all the things he himself implies in TLJ. It’s a story of a young man who is lost because those he is supposed to trust betray him, which is exactly what Snoke/Palpatine want. It shows he didn’t really have a choice in the path he took and it makes his redemption at the end of the saga powerful, even if the last movie itself destroys the myth of Star Wars. I love knowing that Rey and Ben have always had a connection and I hope that is something explored more deeply in Episode X when they bring Ben back.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 30, 2020
M
Verified Purchase
Maekar's Mark
Belleville, US
★★★★★ 5
Answers a lot of questions
Format: Kindle
I enjoyed this story. This fills in a lot of gaps left open from the sequel trilogy, and the artwork was pretty cool. Excellent coloring and layout.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2023
D
Verified Purchase
Danny Carvajal
Belleville, US
★★★★★ 5
Better than the Chronicles
Format: Paperback
I hope DC keeps on publishing these omnibus series up to the silver age and also the softcover option. I much prefer these new softcover editions over the older chronicles series for several reasons. These STGA softcovers are very big almost twice the stories compared to the chronicles and at a very affordable price. Actually a very good price. Also the paper is one hundred times better, I hated the chronicles' paper. Amazon is wonderful too, they now deliver my comics to my house in Costa Rica in less than a couple of weeks, they always arrive before the scheduled time. Excellent service. The only thing to complain is the reproduction. I consider that Marvel makes better efforts than DC to restore their GA stuff. The Cory Sedlemeier books like the Marvel Comics Golden Age omnibus look like they were drawn this morning. DC is usually quite cheaper and prefers not invest in that. So we get the same results as the old early 2000s Archives. I know today it is impossible to get original art pages of action comics 1-10 But I still think that compared to Marvel DC is very lazy and a skintflint when it comes to restoring their old books.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2018
D
Verified Purchase
DJN
Chelsea, US
★★★★★ 5
Fun!!!
Format: Kindle
Obviously dated but still lots of fun! From a cultural point of view, the art and storytelling were interesting. Certainly work a look!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2025
J
Verified Purchase
Jay jay chavez
Draper, US
★★★★★ 4
Got it for my college class, it was a required text.
Format: Paperback
Got this book for one my college class, no joke this was a required text. But overall it was an okay read, only reason why I gave it a 4 out 5 is because I prefer to read books for enjoyment and interest, reading a book for class takes that away.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025

recommand products