SKU: 4376509055

Human NF-H(Neurofilament heavy polypeptide) , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NF-H(Neurofilament heavy polypeptide) , His tagProduct Specification Species Human Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH Accession P12036 Amino Acid Sequence Protein sequence(P12036, Met1 Gln100, with C 10*His) MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 5kDa Actual: 11 30kDa Purity 95% by SDS PAGE Endotoxin <1EU g

Product Specification


Species Human
Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH
Accession P12036
Amino Acid Sequence

Protein sequence(P12036, Met1-Gln100, with C-10*His)
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.5kDa Actual:11-30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Neurofilament, heavy polypeptide (NEFH) is a protein that in humans is encoded by the NEFH gene.It is the gene for a heavy protein subunit that is combined with medium and light subunits to make neurofilaments, which form the framework for nerve cells.Mutations in the NEFH gene are associated with Charcot-Marie-Tooth disease. Neurofilament heavy (NEFH) is one of the critical proteins required for the formation of the neuronal cytoskeleton and polymorphisms in NEFH are reported as a rare cause of sporadic ALS (sALS).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 4376509055

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon User
Omaha, US
★★★★★ 5
Soccer ball just for dogs
Size: 6 Inch Diameter, Color: Ocean Blue
I could say "soccer", and our shoodle would wag her tail ready to play soccer with a tennis ball so I tried out this real soccer ball with her. Mostly, she just wants to wait for me to kick it, playing defense, so she can chase it like the tennis ball. After that she wants to usually bite it or roll over on top of it as a way to secure the ball, but sometimes she will have fun pushing it around with her nose or paws. She still prefers the frisbee for play time outside since the frisbee is good for catching and for playing tug-o-war, but this is a good alternative that always gets her wagging with excitement. I wanted to get a regular 6" soccer ball for our shoodle, but this was a good choice for dogs for the durability and safety of the rubber material. The hexagons give the dog some grip to pick it up. The rubber is soft enough to grip and expel air when they do figure out how to grip it. The ball is designed to suck back in air when the dog releases the ball. - Durable rubber material ideal for dogs - Dog can squeeze out air to grip it - Ball fills back up with air after air is squeezed out - Can make more noise than a leather soccer ball - Noise is still tolerable when used indoors
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
Z
Verified Purchase
Zachary shock
Omaha, US
★★★★★ 5
Good for aggressive cheers. Reinflates everytime even when punctured
Size: 6 Inch Diameter, Color: Apple Green
I have an aggressive cheer that will tear apart anything. I bought this a few months ago and it is covered in puncture holes but it reinflates everytime. Best dog toy ever she loves it. I would buy a dozen of these. The medium size is perfect for my mini bull terrier. Big enough to not get completely in her mouth but small enough that she can still grip it to carry it around
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
L
Verified Purchase
L Stoltzman
Dallas, US
★★★★★ 5
Dog approved for fun, human approved for durability for the price.
Size: 8 Inch Diameter, Color: Orange
This has been my dogs favorite outdoor toy for years . I love these because they are durable and won't deflate when bitten or when carried around in their mouth.... no matter how many holes the dogs put in them. We leave these outside year round even in Minnesota winters. It is strong enough to hold up yet soft enough to be safe on their teeth. Now I do want to say although it is really durable it is not indescribable. IF you have a heavy chewer or a dog that loves to destroy toys, they would need supervision with this I think. My dogs don't try to chew this up but they do wear out over time. We replace it every 2 to 3 years on average. Definitely dog approved and recommended in my home, and human approved for cost and durability. I hope your dogs love it as much as mine do.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
J
Verified Purchase
Jamie P.
Lake Worth, US
★★★★★ 5
Best ball for dogs!
Size: 8 Inch Diameter, Color: Red
This is the best quality and long lasting ball for dogs. It's soft enough to kick and durable enough to where they can chew and chew and it will not lose It's shape. We play hardcore everyday for months and it holds up. Never have to worry about chunks falling off and peeling. Border Collie approved!! Also, $8 cheaper off amazon VS pet store or pet store website. You'll know when it has to be replaced once you have to manually re-inflate with your hands but thats after many many months.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
J
Verified Purchase
Jonathan
Birmingham, US
★★★★★ 4
GOOD BALL
Size: 6 Inch Diameter, Color: Apple Green
This is my second time buying this ball for my blue heeler, and it is easily his favorite toy. It is very sturdy, especially for hard-playing dogs, and handles rough outdoor play sessions effortlessly. The design is brilliant because it does not go flat, yet my dog is still able to bite it and get a good grip on it. It’s the perfect combination of being tough but still flexible enough for a dog to enjoy carrying around. For comparison, our first ball finally stayed flat after a solid 2 months of non-stop, hardcore playing, which is a massive win compared to other toys he destroys in minutes. If you have an active, high-energy dog that loves to play rough, this ball is highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026

recommand products