Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 15 - Aug 20
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human NF-H(Neurofilament heavy polypeptide) , His tagProduct Specification Species Human Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH Accession P12036 Amino Acid Sequence Protein sequence(P12036, Met1 Gln100, with C 10*His) MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 5kDa Actual: 11 30kDa Purity 95% by SDS PAGE Endotoxin <1EU g
Product Specification
| Species | Human |
| Synonyms | 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH |
| Accession | P12036 |
| Amino Acid Sequence | Protein sequence(P12036, Met1-Gln100, with C-10*His) |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:11.5kDa Actual:11-30kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Neurofilament, heavy polypeptide (NEFH) is a protein that in humans is encoded by the NEFH gene.It is the gene for a heavy protein subunit that is combined with medium and light subunits to make neurofilaments, which form the framework for nerve cells.Mutations in the NEFH gene are associated with Charcot-Marie-Tooth disease. Neurofilament heavy (NEFH) is one of the critical proteins required for the formation of the neuronal cytoskeleton and polymorphisms in NEFH are reported as a rare cause of sporadic ALS (sALS).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy