Pay in installments of $61.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 1 - Aug 6
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD155/PVR His Tag Protein, MouseProduct Specification Species Mouse Synonyms FLJ25946, PVS, TAGE4, HVED, NECL5 Accession Q8K094 Amino Acid Sequence Asp29 Leu348, with C terminal 8*His
Product Specification
| Species | Mouse |
| Synonyms | FLJ25946, PVS, TAGE4, HVED, NECL5 |
| Accession | Q8K094 |
| Amino Acid Sequence | Asp29-Leu348, with C-terminal 8*His DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 50-70kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Liu Lu ,Wang Ying ,Geng Chen,Wang Aihong ,Han Sai
,You Xuewu ,Sun Yu ,Zhang Junhua ,Lu Wei ,Zhang Youzhong. CD155 Promotes the
Progression of Cervical Cancer Cells Through AKT/mTOR and NF-kappa B Pathways.
[J] FRONTIERS IN ONCOLOGY.2021-07-05(11). |
Background
CD155 is a member of the immunoglobulin superfamily also known as the human receptor for poliovirus (PVR). The full length (or PVR alpha isoform) is synthesized as a 417 amino acid (aa) precursor that contains a 20aa signal sequence, a 323aa extracellular region, a 24aa TM segment and a 50aa cytoplasmic tail. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhesion, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. CD155 is expressed at high levels in several human malignancies and seems to have pro tumorigenic and therapeutically attractive properties that are currently being investigated in the field of recombinant oncolytic viro therapy.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy