SKU: 43836693497

Nucleocapsid CTD His Tag Protein, SARS-CoV-2

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Nucleocapsid CTD His Tag Protein, SARS-CoV-2Product Specification Species SARS CoV 2 Synonyms SARS CoV 2 coronavirus NP Protein; SARS CoV 2 np Protein; SARS CoV 2 novel coronavirus Nucleoprotein Protein Accession P0DTC9 Amino Acid Sequence MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP. Expression System E. coli Molecular Weight 14. 5 kDa () Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g

Product Specification


Species SARS-CoV-2
Synonyms SARS-CoV-2 coronavirus NP Protein; SARS-CoV-2 np Protein; SARS-CoV-2 novel coronavirus Nucleoprotein Protein
Accession P0DTC9
Amino Acid Sequence MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP.
Expression System E.coli
Molecular Weight 14.5 kDa (还原状态)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM PB, 100mM NaCl, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Nucleocapsid, nucleocapsid protein, is an important structural protein of novel coronavirus SARS-CoV-2, which is responsible for wrapping the virus RNA genome and then assembling virus particles. Nucleocapsid has two domains: NTD and CTD, in which CTD has two functions: binding to RNA genome and forming homodimer. There are many positively charged amino acid residues on the surface of CTD protein, which can bind to the negatively charged RNA genome by charge interaction. The two molecules of CTD can form a homodimer through the hydrophobic interaction between β-strands, and then form a higher-order polymer complex. Therefore, CTD plays an important role in the process of virus replication and assembly. In the process of novel coronavirus SARS-CoV-2 therapeutic drug development, CTD inhibitors have become a hot target for drug screening. At the same time, the antigen detection kit developed for CTD provides a more efficient and accurate detection method for SARS-CoV-2 detection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43836693497

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jellyshodi
Port Orchard, US
★★★★★ 5
Golden approved
My golden retriever’s really enjoy these chew toys. They are pretty durable and last awhile. They are hard plastic but they do get rough edges after they’ve been chewed in for awhile
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
S
Verified Purchase
Steven S.
Bozeman, US
★★★★★ 5
Perfect for chewy doggos
My dogs loved them! Keeps them entertained for a few mins. You can also fill with PB and freeze. Or yogurt and freeze. Great for the doggos
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
E
Verified Purchase
Erika
New York, US
★★★★★ 5
Amazing!!
The dogs love them!!! They have not been able to destroy them at all!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
B
Verified Purchase
BrandiLynn0311
Natrona Heights, US
★★★★★ 5
Mixed Results: SIHRMIU Dog Chew Toys Offered Stimulation, Limited Interest from Aggressive Chewers
I recently purchased the SIHRMIU 2 Pack Dog Chew Toys for Aggressive Chewers with hopes of providing my energetic dogs with both entertainment and stimulation. While these toys boasted durability and were designed to alleviate boredom, my experience with them yielded mixed results. Upon receiving the chew toys, I appreciated their sturdy construction and the promise of durability, which was essential given my dogs' penchant for aggressive chewing. The variety of textures and shapes seemed promising, offering potential for engaging play sessions that could keep my pets occupied and mentally stimulated. Initially, my dogs showed some interest in the toys, eagerly sniffing and exploring them. They seemed intrigued by the different textures and shapes, and I was hopeful that these toys would provide the entertainment they needed. However, as my dogs began to interact more with the toys, it became evident that their interest was short-lived. While they engaged with the toys for brief periods, they quickly lost interest and returned to their usual chewing favorites. Despite their designation for aggressive chewers, the toys did not seem to withstand the intense chewing of my pets as well as expected. Within a short time, I noticed signs of wear and tear, with pieces starting to break off. While the SIHRMIU dog chew toys offered some stimulation and diversion for my dogs, they ultimately failed to hold their interest or stand up to their aggressive chewing habits. While they may be suitable for dogs with less voracious chewing tendencies, they were not a perfect fit for my pets. In conclusion, while these chew toys have potential and may work well for some dogs, they fell short of expectations for my aggressive chewers. I appreciate the effort put into their design and durability, but unfortunately, they did not meet the needs of my furry companions.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2024
M
Verified Purchase
Melissa Embury
Grantham, US
★★★★★ 5
Chew rope
Size: Small 15", Style: 3 Knot, Pattern Name: Dog, Size: Small 15", Style: 3 Knot, Pattern Name: Dog
Works great for my goldendoodle. It’s held up well to two dogs and lots of playing. It’s nice and large and has held up outdoors in Michigan winters
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026

recommand products