Pay in installments of $87.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 12 - Aug 17
For Your Every Summer RSVP, with Code: SUMMER15
Description
MDL-1 /CLEC5A His Tag Protein, HumanProduct Specification Species Human Synonyms CLEC5A Accession Q9NY25 Amino Acid Sequence Pro 28 Lys188,with N terminal 9*His HHHHHHHHHDDDDKPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK Expression System HEK293 Molecular Weight 33 45 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | CLEC5A |
| Accession | Q9NY25 |
| Amino Acid Sequence | Pro 28-Lys188,with N-terminal 9*His HHHHHHHHHDDDDKPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK |
| Expression System | HEK293 |
| Molecular Weight | 33-45 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
CLEC5A is a spleen tyrosine kinase (Syk)-coupled C-type lectin that is highly expressed by monocytes, macrophages, neutrophils, and dendritic cells and interacts with virions directly, via terminal fucose and mannose moieties of viral glycans. CLEC5A also binds to N-acetyl glucosamine(GlcNAc) and N-acetylmuramic acid(MurNAc) disaccharides of bacterial cell walls. Compared to other C-type lectins(DC-SIGN and DC-SIGNR) and TLRs, CLEC5A binds its ligands with relatively low affinities. However, CLEC5A forms a multivalent hetero-complex with DC-SIGN and other C-type lectins upon engagement with ligands, and thereby mediates microbe-induced inflammatory responses via activation of Syk. For example, in vivo studies in mouse models have demonstrated that CLEC5A is responsible for flaviviruses-induced hemorrhagic shock and neuroinflammation, and a CLEC5A polymorphism in humans is associated with disease severity following infection with dengue virus. In addition, CLEC5A is co-activated with TLR2 by Listeria and Staphylococcus. Furthermore, CLEC5A-postive myeloid cells are responsible for Concanavilin A-induced aseptic inflammatory reactions. Thus, CLEC5A is apromis-Cuous pattern recognition receptor in myeloid cells and is a potential therapeutic target for attenuation of both septic and aseptic inflammatory reactions.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 23 reviews
Sort
Product Reviews
★★★★★ 5
Strongest iv found so far
Pattern Name: Ball, Size: Large - 3 Inch / 12 oz
It lasted longer than most but it’s in pieces after 2 weeks
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2026
★★★★★ 5
Awesome Ball
Pattern Name: Ball, Size: Large - 3 Inch / 12 oz
This ball is so awesome my dog can't chew it all..and was not expensive
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
★★★★★ 1
A total joke.
Pattern Name: Cage Ball, Size: Large - 4 Inch / 8.5 oz
I was so hopeful and really wanted this to be as good as the sellers claimed. After all, they boast of a lifetime replacement (a joke and be sure to read the ridiculous terms lol). I have a "pocket pitty" and she loves rubber toys. There is not much I have found that can withstand her force; however, reading reviews AND seeing their warranty, I wanted to give it a try. Typically, I stick with Java wood and XL super dense knotted ropes, as that has been the only thing that can last any real amount of time. Thankfully, she never goes after our stuff or household items/furniture, just her toys.
The ball arrived. I checked it over. It looked semi promising. I was hopeful. The design does allow for them to leverage their paw strength by getting it between the rubber bars and then pull with their teeth. Within 3 minutes of her having it, she already had a bar ripped off. Within 5 minutes, she had 3 bars ripped off. Don't get me wrong, she had a blast. But this is by no means strong enough for an actual aggressive chewer. Perhaps there is just not anything rubber that can handle her jaws, but now I can't get a replacement because the warranty only covers if the product is defective. It doesn't cover chewing damage (on any of their products). The advertising is very misleading so be aware. Why a replacement if she will just destroy it again you may wonder? She loves to go after a ball, but now I know she can kill this one, I keep them in a drawer and only let her play fetch with it while supervised.
I will say though, I you have a puppy, I think this would be great for them as long as they are not extra large. The material has give, which is nice. But if you have a real aggressive chewer, don't waste the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2023
★★★★★ 4
Not indestructible, but is very tough.
Pattern Name: Ball, Size: Large - 3 Inch / 12 oz
My dog destroyed this, but it took a little longer than it usually does. Would love to know how the lifetime replacement works. There is no information that I see on how to contact the seller.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 8, 2025
★★★★★ 5
Would buy again
Pattern Name: Cage Ball, Size: Large - 4 Inch / 8.5 oz
This is a great ball! Both my dogs love it. Queensland is a heavy chewer and I can see no damage. Catahoula loves to fetch and kick after kick and retrieval this ball shows no wear. It’s easy to pick up and is a good size for my dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 11, 2025