SKU: 47350577928

Human CD59, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD59, His tagProduct Specification Species Human Synonyms 1F5 antigen, 20 kDa homologous restriction factor (HRF 20; HRF20), MAC inhibitory protein (MAC IP), MEM43 antigen, Membrane attack complex inhibition factor (MACIF), Membrane inhibitor of reactive lysis (MIRL), Protectin Accession P13987 Amino Acid Sequence Protein sequence(P13987, Leu26 Asn102, with C 10*His) LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGGGSHHHHHHHHHH

Product Specification


Species Human
Synonyms 1F5 antigen, 20 kDa homologous restriction factor (HRF-20; HRF20), MAC-inhibitory protein (MAC-IP), MEM43 antigen, Membrane attack complex inhibition factor (MACIF), Membrane inhibitor of reactive lysis (MIRL), Protectin
Accession P13987
Amino Acid Sequence

Protein sequence(P13987, Leu26-Asn102, with C-10*His) LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:10.6kDa Actual:11, 15kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD59 glycoprotein, also known as MAC-inhibitory protein (MAC-IP), membrane inhibitor of reactive lysis (MIRL), or protectin, is a protein that in humans is encoded by the CD59 gene. CD59 attaches to host cells via a glycophosphatidylinositol (GPI) anchor. When complement activation leads to deposition of C5b678 on host cells, CD59 can prevent C9 from polymerizing and forming the complement membrane attack complex. It may also signal the cell to perform active measures such as endocytosis of the CD59-C9 complex. Viruses such as HIV, human cytomegalovirus and vaccinia incorporate host cell CD59 into their own viral envelope to prevent lysis by complement.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47350577928

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Dallas, US
★★★★★ 5
Very well made chew bone!
Color: 1 PC-Beef-Red
Great durable, very well made chew bone! Our dog usually tears up all his toys within a few minutes or sometimes hours after he gets them. He’s had this bone for a few days and it’s still in one piece. Except for the rubber that’s in the middle, he chewed up in a couple of days. I would definitely buy more chew toys made by this company! Well worth the money!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
P
Verified Purchase
Pittieluv79
Los Angeles, US
★★★★★ 3
The rubber middle is not durable, it lasted less than 3 hours.
Color: 1 PC-Beef-Red
I bought this as I have bully/husky puppies (9 months old) and a pitt/doberman (9 years old). They are heavy chewers and destroy everything. I saw a video of this toy. The woman said that her dog chewed on it for a while (about 2 hours or so) she showed the ends visibly chewed, which I expect but it was holding up. The rubber middle seemed to hold up to. I received this yesterday. I had to take it away from them last night as they were chewing the rubber middle off. They had it maybe 3 hours. I didn't give it a lower star score as I will just cut the rubber off and give it back to them. So I was disappointed in the rubber middle not being more durable but the hard plastic it's made from is the strong material they need.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
B
Verified Purchase
BLACKHAWKS
Lowell, US
★★★★★ 5
Bones
Color: 1 PC-Beef-Red
Yes bone 🍖 is very strong and durable MIA, Rocky and Rambo love them ..
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
L
Verified Purchase
Lexi
Louisville, US
★★★★★ 4
Smaller than pictured but still a good choice for LG-XL dogs/power chewers!
Color: 3 PC-Beef-Red, Color: 3 PC-Beef-Red
Fantastic that these come in a 3 pack - I wish more chew toys did this! The base for these chew toys is pretty tough! The center & ends are hard enough to withstand both my bully mixes & my Irish wolfhound/Great Dane cross. They’re safe enough for even the largest power chewers! (With Supervision) my American Bully got the rubber spikes chewed off in under 20 minutes which is mildly disappointing but he’s a true powerhouse & master destroyer of all chews so I’m not that bent out of shape about it. I do wish they were as large as they appear in the ad pics but isn’t that the game we all play ordering offline anymore? 🤷🏻‍♀️ • Pro Tip: smear this toy in peanut butter (xylitol free!), wet food mixed into a slurry with water or bone broth + kibble/treats, yogurt, or even pumpkin puree and freeze for a few hours & relax while watching all the organic engagement your dog gets out of this toy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
M
Verified Purchase
manuel rodriguez
Dallas, US
★★★★★ 5
My dog loves it
Color: 1 PC-Beef-Red, Color: 1 PC-Beef-Red
The bone arrived today and my dog loves it. He is a very aggressive chewer and destroyed almost all his toys so far, even toys that were advertised for aggressive chewers unfortunately didn't held out long, the longest so far was a stuffy we couldn't find anymore and that one lasted him a few weeks but everything else lasted him an hour up to a few days max, even bones don't last him long so we have our hopes set on this bone to satisfy his chewing needs. I will update my review later on sturdiness, since we just got it and I can't review that yet but so far he loves it he has been chewing on it non stop, he already managed to get very small pieces of as shown in picture but with a regular bone he would've already been much much further. The bone is only 10 bucks so the value for money you get based on my experience so far is amazing! But also for this I will come back later to touch upon more. The size is good, our boy is a medium sized dog and this bone was advertised for medium to large size dogs and I thinks the size is just right for our boy . And there is definitely a beef flavor on it you can smell it but it doesn't smell bad it's a nice smell and not very strong but when he is chewing on it you smell it. I would based on my experience so far definitely recommend this bone but also on this I will touch back upon later if it's worth it in the long run. So far a very happy dog and owners here. Edit on May 8th (original review was on March 11th) He still hasn't managed to destroy it it's the first (cgew)toy he hasn't managed to destroy yet which is very impressive since he managed to destroy the even most toughest things we got for him in a week tops and bones within 1, 2 days tops, so we are very happy and pleased with this bone and will definitely get more later. He still enjoys chewing on it and leaves our things mostly alone for some reason he just likes stealing my things and chew on it lol. So 2 months later still stand by recommending this when your dog loves to chew and destroys everything he puts his mouth on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2026

recommand products