Pay in installments of $21.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Rat C5a Protein, His tagProduct Specification Species Rat Synonyms Complement C5, C5a anaphylatoxin Accession P08650 Amino Acid Sequence Protein sequence (P08650, Asp679 Arg755, with C His tag) DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR Expression System HEK293 Molecular Weight Predicted MW: 10. 7 kDa Observed MW: 10. 7 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag with C His tag Physical Appearance Lyophilized
Product Specification
| Species | Rat |
| Synonyms | Complement C5, C5a anaphylatoxin |
| Accession | P08650 |
| Amino Acid Sequence | Protein sequence (P08650, Asp679-Arg755, with C-His tag) DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 10.7 kDa Observed MW: 10.7 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | with C-His tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
C5a anaphylatoxin is a potent inflammatory mediator in the complement system. It is generated during the cleavage of complement component C5. With a relatively small molecular weight, C5a possesses remarkable biological activities. It acts as a chemoattractant, drawing various immune cells like neutrophils, monocytes, and eosinophils to the site of inflammation. Additionally, C5a can activate these immune cells, enhancing their phagocytic ability and promoting the release of inflammatory cytokines and chemokines. Moreover, C5a plays a role in increasing vascular permeability, which facilitates the migration of immune cells and plasma proteins from the bloodstream to the inflamed tissue. Dysregulation of C5a has been implicated in numerous inflammatory and autoimmune diseases, making it a crucial target for therapeutic interventions.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy