SKU: 49549601525

EPHA7 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 19 - Aug 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPHA7 ProteinProduct Specification Species Human Accession Q15375 1 Amino Acid Sequence E595 V998(end)

Product Specification


Species Human
Accession Q15375-1
Amino Acid Sequence

E595-V998(end)

ELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSLKTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV

Expression System Baculovirus-InsectCells
Molecular Weight 72.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 20mM Reduced Glu, 0.05% Brij-35, 10% glycerol, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49549601525

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
IntelliCABlonde
Los Angeles, US
★★★★★ 5
Nice toy for a bigger dog
Color: Gray, Size: 6 IN
My little rescue chihuahua has exactly one toy he can make squeak. This one is cute and he did try, but no luck. I have two large baskets of toys I've bought in the 3 years I've had him. He is only able to make one squeak. He loves it to death because he loves the squeak. It's a hedgehog that I will try to find on Amazon and replace. Poor little dog just has a very small mouth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
A
Verified Purchase
Al
Lowell, US
★★★★★ 5
Semi durable
Color: Gray, Size: 8 IN
My dog has had this for 1 month, and it is still doing good! It has lost 3 out of 4 legs, but thw body is pretty strong. Dog loves the honk noises.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
P
Verified Purchase
princeton von d
Phoenix, US
★★★★★ 5
Luxurious Feel, Durable Build… but Full Rotation Privileges Have Been Revoked 💙🦴 🐾
Color: Blue, Size: 6 IN, Color: Blue, Size: 6 IN
🐾 Hi, I’m PVD; toy curator, plush critic & occasional chew sommelier. This armadillo arrived beautifully packaged and immediately met my standards for texture, squeak clarity and cuddle factor. I originally gave it 5 stars for quality; and still do! But today I’m updating the review to reflect my current toy lifestyle rotation. 😌 What impressed me from day one: ✔️ High-end plush feel; soft enough to nap on, tough enough for energetic zoom bites and great relief from teething ✔️ Strong stitching; survived multiple “stress tests” (I chewed with intention) ✔️ HQ squeaker; not tinny or annoying, more of a honk ✔️ 6in is perfect size for small breeds; easy to carry during dramatic hallway walks Why it now gets 4 stars from a seasoned toy collector: ✘ As my luxury toy collection expanded, this one gets grabbed less often ✘ Simple design; I now favor more interactive or complex textures ✘ Still “keep-worthy,” just no longer VIP spot on the chaise lounge Best For: • Pups who enjoy soft comfort toys or emotional support snuggles • Light to moderate chewers • Dogs who like to carry their plushes around proudly • Ideal as a teething toy or thoughtful gift 🚫 Not ideal for: power chewers or highly stimulation-driven pups (like me now; my taste evolved) 📝 Final Re-Barks: Still recommend for pups who love cuddly squeaky companions. Great starter plush and great quality; just know that ultra-picky toy enthusiasts may rotate it out once newer models (or squeakier friends) arrive. — PVD (Plush Aficionado, Toy Rotation Director & High-Maintenance Household Icon) 🐶💁🏻‍♂️✨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2025
S
Verified Purchase
Sarah
Dallas, US
★★★★★ 4
Well Constructed Toy But Short-Life Squeaker
Color: Gray, Size: 8 IN
Super cute and durable toy. Makes a "grunting" noise that my dog loves. However rating a little lower because my dog has only been playing with it (gently) for a couple weeks and the grunting noise is starting to die. But she does really like this toy regardless!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
S
Verified Purchase
Scoobie Doo
Port Orchard, US
★★★★★ 5
Cute and soft dog toy!
Color: Gray, Size: 8 IN
This very cute armadillo dog toy is nice and soft for our Golden Retriever to carry around in his mouth. He eventually likes to pull off the legs, ears, or anything else extending from the body of the toy and so far he hasn’t been able to do so with this one. Not saying that it’s not possible, so as with any toy, you should monitor your dog playing with it as we definitely have to. He also likes to continually make his toys squeak and this toy’s squeaker works very well!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026

recommand products