SKU: 50470267750

Human MUC5AC , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MUC5AC , His tagProduct Specification Species Human Synonyms Gastric mucin, Major airway glycoprotein, Mucin 5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM Accession P98088 Amino Acid Sequence Protein sequence(P98088, Thr1850 Cys1950, with C 10*His) TSTPGSTSSSPAQTTPSTTSKTTETQASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 3kDa Actual: 20 120kDa Purity

Product Specification


Species Human
Synonyms Gastric mucin, Major airway glycoprotein, Mucin-5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM
Accession P98088
Amino Acid Sequence

Protein sequence(P98088, Thr1850-Cys1950, with C-10*His) TSTPGSTSSSPAQTTPSTTSKTTETQASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.3kDa Actual:20-120kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

MUC-5AC is a large gel-forming glycoprotein. In the respiratory tract it protects against infection by binding to inhaled pathogens that are subsequently removed by mucociliary clearance. Overproduction of MUC-5AC can contribute to diseases such as asthma and chronic obstructive pulmonary disease, and has also been associated with greater protection against influenza infection. This protein has been linked to mucus hypersecretion in the respiratory tract and is associated to chronic obstructive pulmonary disease (COPD).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50470267750

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Book Junkie
Boise, US
★★★★★ 5
Best dog ball in the world!
Size: Large, Pattern Name: Pack of 1, Size: Large, Pattern Name: Pack of 1
My dog is singularly obsessed with playing ball. He would drop a steak to chase a ball. (He'd return to the steak, but not without the retrieved ball. He's not an idiot.) He makes dangerous leaps, crashes into trees, and runs fast enough to catch thrown balls before they even hit the ground. Since he doesn't care about his own wellbeing, it's my job to protect him as much as I can. And a lot of balls are hard enough to cause him pain or dental damage when he mistimes a catch. Enter the ChuckIt Glow Ball! The minute Cowboy got his first Glow Ball, he no longer had any interest in the dozens of tennis balls scattered around the house and yard. If I took the Glow Ball away and instead threw a tennis ball, Cowboy would run to retrieve the ball, then return without it and begin looking all over the house for the Glow Ball. The Glow Ball is tough enough to survive Cowboy's big, sharp chompers, yet it's soft enough to do no harm when it hits him in the face. The glow feature is a huge bonus, too. Cowboy gets distracted by chipmunks and squirrels when we're playing, so he sometimes can't remember where he dropped the ball to pursue the interloper. If the ball was exposed to enough light before it was misplaced, it will be easy to find once the sun goes down. (Otherwise, Cowboy always finds it eventually.) When I'm feeling nocturnal, I'll put the ball under a light for a few minutes to activate the electrons, then treat my boy to a middle-of-the-night game of fetch. I was so happy to see these on sale, I bought a lifetime supply for my pantry. The size guide seems accurate. ChuckIt recommended the large size for a dog of Cowboy's weight and that size is perfect. Highly recommended product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 14, 2024
G
Verified Purchase
Gus
West Palm Beach, US
★★★★★ 5
Heavy chewer approved.
Style: Ball, Size: Medium (Pack of 1)
My pomsky will destroy a toy in minutes. Ropes, and the "indestructible" nylon type stuffs are no match for my furry shark. This ball has stood up to him like David. He loves the crunch and it is so much more tolerable than a squeaker. These will be a staple in his toy box - Chuckit toys are really the most durable dog toys I have found in three years.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
G
Verified Purchase
Gold Coast
Lake Worth, US
★★★★★ 5
Fun Ball
Style: Ball, Size: Medium (Pack of 2)
Great new ball for our pup. He loves the sound of the crunch!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
C
Verified Purchase
Cheryl
Houston, US
★★★★★ 5
Durability
Style: Ball, Size: Medium (Pack of 2)
My dog loves these balls!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
S
Verified Purchase
ShainaKatt
Draper, US
★★★★★ 5
Dogs love them
Style: Ball, Size: Medium (Pack of 2)
Our dogs love these. What’s great is that you can add more plastic (like from water bottles) if the plastic starts to fall out from the center. If you have a chewer, though, these won’t last you long. Our shepherd mix loves these and then starts to pull the rubber apart the more she plays with it. Our other dogs treat it normally, though, and those ones last forever. They also get some decent height when bounced, and they make a unique whistling noise when thrown.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 17, 2025

recommand products