SKU: 50671232315

Biotinylated CD40 Fc&Avi Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD40 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5 Accession P25942 Amino Acid Sequence Glu21 Arg193, with C terminal Human IgG1 Fc & Avi Tag

Product Specification


Species Human
Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5
Accession P25942
Amino Acid Sequence

Glu21-Arg193, with C-terminal Human IgG1 Fc & Avi Tag EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

55-60kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Chatzigeorgiou A, et al. (2009) CD40/CD40L signaling and its implication in health and disease. Biofactors. 35(6): 474-83.

2、Li R. et al. (2009) Expression of CD40 and CD40L in Gastric Cancer Tissue and Its Clinical Significance. Int J Mol Sci. 10(9): 3900-17.

3、Lievens D. et al. (2009) The multi-functionality of CD40L and its receptor CD40 in atherosclerosis. Thromb Haemost. 102(2): 206-14.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50671232315

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Christine Cassara
Grantham, US
★★★★★ 5
MUST HAVE!!! Dog is obsessed!!!
Color: Aqua
100 PLUS STARS!!! We have a very VERY active pup (6 yrs old 🤦‍♀️🤦‍♀️)… he has destroyed EVERYTHING we have ever given him. So I ordered this AND the replacement shell. He has chewed the ball extensively but it is in PERFECT shape, no need for the replacement one YET.. I can not rave about this enough - he LOVES it, we love watching him with it and he won’t let it out of his site at all!! If we touch it he gets upset.. so when we charge it, we put the shell back together and give him that.. which reminds me - make sure you have that screwed TIGHT.. somehow he was able to get it apart.. but once we started tightening it he hasn’t been able to.. thinking about it?? GET IT!! You won’t be disappointed and neither will your dog!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2025
Q
Verified Purchase
Quality Questionnaire
Phoenix, US
★★★★★ 4
An expensive ball to think about
Color: Aqua
Went with the foam ball because I have hopes that my dogs teeth will sink in enough to be satisfying without having to shred it like a tennis ball. So far, so good. I chose this one because the of the outer shell replacement possibility; assurance that 30 dollars towards a ball would have an extended life option for half the price if needed. It is slightly bigger than a tennis ball and big enough for my dog to be unable to get a strong clench and crush it. He does try though and it's holding up. All of the options and modes are great. However, I wish it acted more of a bait ball. Going through all three of the modes, I can't say any have sparked a wild chase. It will bounce intermittently or once touched. The intervals are long enough to lose my dogs interests. Short intervals make the ball the easy loser every time. Better on hardwood but pathetic on carpet. It will roll but not far or very fast. The only positives from this may be the battery conservation but when he stops playing with it, it is still rolling around the room. I think it takes 20-30 minutes of inactivity for sleep mode. With this, the charge will last about a day of play. It does charge quickly. It has passed the tough chewer test with one who can chew through "tuff" toys in no time but I wish it was more of a challenge. After telling my sister i purchased one, she said she would've given me hers because her dog had lost interest. Go with your hunch and find another game to invest in if you have trepidations of this being this case. I won't deduct anymore stars because the product is as advertised. Only one deducted for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 19, 2025
S
Verified Purchase
Sheila Lati
Lake Worth, US
★★★★★ 5
So far so good
Color: Aqua
For the past 2 years I’ve been looking for an interactive ball our dog won’t break within days. I appreciate that it’s all foam, without any ropes or plastic pieces he can chomp on. I don’t let him use it as a chew toy but after catching it he does like to chew on it for a little bit, and it’s held up nicely after a month. Would recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026
R
Verified Purchase
Robert
Port Orchard, US
★★★★★ 2
if vibration excites your dog then it's okay
Color: Aqua
They're okay bit just basically vibrate. Was hoping they would roll around and their own but just really vibrate so my dogs didn't get much from it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 29, 2025
T
Verified Purchase
The Shabby Queen
Boise, US
★★★★★ 4
Please make a smaller one!! LOVE 💕
Color: Aqua, Color: Aqua
Giving a 4 star only because ….you dont have a smaller one!! My dog loves these!!! PLEASE PLEASE PLEASE!!! Make a smaller one!!!….. Just like this one!!!!!! Made very well!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026

recommand products