SKU: 51155274570

Mouse CLEC7A, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CLEC7A, His tagProduct Specification Species Mouse Synonyms Beta glucan receptor, C type lectin superfamily member 12, Dendritic cell associated C type lectin 1(DC associated C type lectin 1; Dectin 1), Bgr, Clecsf12, Dectin1 Accession Q6QLQ4 Amino Acid Sequence Protein sequence (Q6QLQ4, Gly71 Leu244, with C 10*His)

Product Specification


Species Mouse
Synonyms Beta-glucan receptor, C-type lectin superfamily member 12, Dendritic cell-associated C-type lectin 1(DC-associated C-type lectin 1; Dectin-1), Bgr, Clecsf12, Dectin1
Accession Q6QLQ4
Amino Acid Sequence

Protein sequence (Q6QLQ4, Gly71-Leu244, with C-10*His) GHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKELGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21.5 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CLEC7A is a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. It functions as a pattern-recognition receptor for a variety of β-1,3-linked and β-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Expression is found on myeloid dendritic cells, monocytes, macrophages and B cells. The C-type lectin receptors are class of signalling pattern recognition receptors which are involved in antifungal immunity, but also play important roles in immune responses to other pathogens such as bacteria, viruses and nematodes. Also operating as a co-stimulatory molecule via recognition of an endogenous ligand on T-cells, which leads to cellular activation and proliferation, CLEC7A can bind both CD4+ and CD8+ T cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 51155274570

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
William F Marsh
San Leandro, US
★★★★★ 5
Great Everyday Watch
Color: Black
Great product and a great price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
G
Verified Purchase
gen0
Carnegie, US
★★★★★ 5
Infantry 5ATM Waterproof Mens Military Tactical Field Watch, Date & Day 12/24Hr-
Color: Silver
So I almost never write reviews- anywhere. This is an exception & I'm not paid or reimbursed- just impressed. This watch presents a really good price to value ratio. My infantry watch looks great and is very functional. I put a NATO strap on it because I tend to be tough with watches, though the one it arrived with is very nice looking and the buckle is even logo'd- a really nice touch in this price segment. I've received several positive compliments while wearing it and 1 of my friends has purchased an Infantry field watch from this same series since. The company behind the watch is part of the value equation. I had a minor issue and I was able to get in touch with a real person... no, actually two! I contacted via Amazon AND through the support dept from their website. Both inquiries were promptly answered with a helpful and well-mannered reply and the perfect solution. There are several collections to be found on their website (SEARCH: Infantry Watches ). These watches range in appointment and quality from levels found here to several steps above. Similar in looks and nature to this one on Amazon include; The Chronomaster, The Skeleton, and The Auto-Pilot to name a few. I've begun to add additional watches to my collection from those. There are also fun and informal collaborations offered. Right now [8-2025] these include; Transformers, Monopoly, Peanuts and several others. ---> Overall it's rare and refreshing to find a company still able to work decent products AND ethics into a successful business model! Gen0
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025
J
Verified Purchase
John Weiss III
Pawtucket, US
★★★★★ 4
Simple, affordable, smartly styled. Good starter watch for teens
Color: Black
Got this for 13-year-old boy for Christmas. Excellent choice for a beginner's watch. Learn to read a clock face for crying out loud! Easy to set the day/date, and has a comfortable band.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2025
S
Verified Purchase
Soldat !
Charlottesville, US
★★★★★ 5
Style classic
Color: Silver
A neat watch, I was a career soldier and I remember getting a few different military style watches, mostly made by Timex. I was in supply so had access to them, often the style was the same and sometimes not. Item was packed well and arrived fast great price
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
S
Verified Purchase
Steve B., Houston, TX
Dallas, US
★★★★★ 5
Decent watch for the price - you get what you pay for
Color: Black
This watch is about what I expected for the price. It's comfortable to wear and is keeping time reasonably well thus far. Illumination on the hands and dial fades after a couple of hours and setting the day of the week does not work (it will not advance - day just sort of "bounces" in the window - although the day changes on its own). Given the reviews I read, I take it off before showering and avoid getting it wet when washing my hands, as I don't trust the water resistance. EDIT: After posting the generally positive review above, the seller messaged me offering a replacement on their own initiative and allowing me to keep the original watch. I did not expect that but accepted their offer. Upon receiving the replacement, I discovered that the problem setting the day of the week was user error and not a problem with the 1st watch. My only criticism of the watch remains that the illumination fades within an hour or two (I held it next to a 150W lamp bulb for 30 seconds) but I am willing to live with that and believe the watch is a good value. I increased my rating from 3-stars to 5-stars on the strength of the great customer support and what I think is the value proposition for a very comfortable, easy to read, $20 watch. I would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026

recommand products