SKU: 51610848139

IL-13 Protein, Human

Sale price$91.80 Regular price$102.00
Save 10%

Pay in installments of $25.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-13 Protein, HumanProduct Specification Species Human Synonyms IL13, ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin 13 Accession P35225 Amino Acid Sequence Gly35 Asn146, with C terminal 8*His GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGSHHHHHHHH Expression System HEK293 Molecular Weight 30 35kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms IL13, ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin-13
Accession P35225
Amino Acid Sequence

Gly35-Asn146, with C-terminal 8*His GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 30-35kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Comparative Study Protein Expr Purif . 1998 Mar;12(2):239-48.

Background

Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. Interleukin 13 is a single-chain glycosylated polypeptide, which belongs to the IL-13/IL-4 family. IL-13 induces its effects through a multi-subunit receptor that includes the alpha chain of the IL-4 receptor (IL-4Rα) and at least one of two known IL-13-specific binding chains. Recent studies have shown that human interleukin-13 has many structural similarities with human interleukin-4 and is produced by gene replication events. As a cytokine, IL-13 protein is critical in regulating inflammatory, immune responses, and diseases.Also, it inhibits the production of pro-inflammatory cytokines and chemokines, and thus down-regulates macrophage activity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 51610848139

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
VeryWendiful
Pawtucket, US
★★★★★ 5
So pretty
Color: 6 Panels Natural, Size: 6 Panels
Beautiful!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 30, 2025
M
Verified Purchase
Miah
Louisville, US
★★★★★ 5
Solid Floating Shelves 🛠️🏠
Color: Black, Number Of Shelves: 4, Size: 15.7in
I have installed four sets of the black floating shelves in my office. They are made of high quality materials, featuring a sophisticated black woodgrain finish with a natural texture. Supposedly, each unit can handle up to 22 pounds, though I would not recommend testing that limit with your vintage bowling ball collection if you value your flooring. They are awesome. The value is good for a set of two. Each shelf measures 22x7x1 (56x17x3 cm) inches, providing a decent amount of storage for books or decor. The installation was straightforward since the hardware for multiple wall types was included. They work well in the kitchen for spices or in the bedroom for personal belongings. One tip for a secure fit: use a level during installation and make sure the bracket is flush against the wall before sliding the shelf on, or your photos might look like they are sliding off a mountain 📐 These shelves offer a clean, modern look and stay stable once mounted correctly. They are a practical choice for adding functional display space to any room 🖼️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
T
Verified Purchase
Tyler Kline
Chelsea, US
★★★★★ 5
Good looking shelves and easy install - skip the included drywall anchors
Color: Black, Number Of Shelves: 2, Size: 22in
I installed these shelves in a bedroom to get things off my dresser and some decor. Once mounted they look really nice. The black finish looks clean and modern and they blend in well with the room. Installation was pretty straightforward. The metal bracket mounts to the wall first and then the shelf slides over the bracket. As long as you take your time lining things up it’s a simple project. One thing I strongly recommend is not using the white plastic self-drilling drywall anchors that come with the kit. I’ve used that style before on other projects and they tend to strip out easily and leave larger holes in drywall. I used better anchors instead and the shelves mounted much more securely. The rest of the hardware worked fine and once installed the shelves feel solid and hold items well. Pros - Clean modern look - Easy installation - Feels solid once mounted - Good size for books or decor Cons - The small level included isn’t very accurate — use your own level - One of the metal brackets was slightly bent out of the box but straightened out easily Helpful tip: Use your own level and better drywall anchors if you have them. It makes installation easier and the shelves will mount much more securely. Final thoughts: For the price these are nice looking floating shelves that install easily and work well for light storage and decor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026
C
Verified Purchase
Coffman, H
Dallas, US
★★★★★ 5
Cheap, and effective!
Color: Black, Number Of Shelves: 4, Size: 15.7in
Looks good, works great, low cost. I'll be purchasing more in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
A
Verified Purchase
Amazon Customer
Dallas, US
★★★★★ 4
Cute for coffee bar!
Color: Black, Number Of Shelves: 4, Size: 15.7in
Great for above my coffee bar. Easy to mount and align. Seems stable!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026

recommand products