SKU: 5185189478

Human IL-10, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 5 - Aug 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-10, His TagProduct Specification Species Human Accession P22301 Amino Acid Sequence SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 19. 6 kDa (Reducing) Purity 90% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4

Product Specification


Species Human
Accession P22301
Amino Acid Sequence

SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight 19.6 kDa (Reducing)
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Use within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

Background

IL-10 (Interlukin-10) is a multicellular and multifunctional cytokine that regulates cell growth and differentiation, participates in inflammatory and immune responses, and is recognized as an inflammatory and immunosuppressive factor. It plays an important role in tumor, infection, organ transplantation, hematopoietic system and cardiovascular system, and is closely related to diseases of blood, digestion, especially cardiovascular system.Overexpression of IL-10 leads to skin leishmaniasis, and IL-10 plays a decisive role in the development of immune paralysis, temporary immune deficiency after trauma, major surgery, burns, shock and high risk bacterial/fungal infections that can be fatal. Macrophage-derived IL-10 is also associated with age-related immune deficiency.Continuous immune activation occurs when IL-10 is relatively or absolutely deficient, which can lead to chronic inflammatory bowel diseases (such as Crohn's disease), psoriasis, rheumatoid arthritis and post-transplant disease, etc.This product is the recombinant human IL-10 protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5185189478

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
NS
West Palm Beach, US
★★★★★ 5
Quickly accepted by our local hummingbirds.
Size: 64 Fl Oz (Pack of 1), Style: 64 oz Ready To Use
I used this in a red hanging hummingbird feeder on a second-floor shaded balcony. The feeder had only been up a short time, and the nectar was accepted quickly. I observed hummingbirds visiting, perching, and drinking from the active lower tiers, so the product clearly did not discourage feeding. What I like most is the convenience. It is ready to pour, clear, and does not require mixing sugar and water. I also appreciate that it is not dyed red. The feeder itself provides enough red visual attraction, so colored liquid is not necessary. For a small balcony feeder, I only needed to fill the reservoirs about halfway, which helped keep the nectar fresh and reduced waste. A few practical notes: I still treat this like any hummingbird nectar and replace it regularly rather than letting it sit for many days. Even in shaded, mild weather, I would rather keep the feeder clean and fresh. The bottle should also be stored properly after opening. Overall, this is a good option if you want a simple ready-to-use nectar without mixing your own. Homemade sugar water is cheaper, but this is convenient, clean-looking, and in my case the hummingbirds used it. I would recommend it for someone who wants an easy pour-and-fill option, especially for a smaller feeder or balcony setup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
R
Verified Purchase
R. Martin
Draper, US
★★★★★ 5
Easy to use. Stays sealed. Stays charged.
Size: 12 Combo Travel Size
I had previously bought packing bags in a store — the kind the you had to seal and then roll/squish the air out of one end of the bag. It really took 2 people to remove most of the air. I took them to Mexico, and they were just OK. I switched to these vacuum bags before our family ski trip. What a great purchase! This set includes multiple sizes, which worked well for both everyday clothes and bulkier cold-weather gear. They also fit well inside different size suitcases. One tip: Fill the bag, seal it shut, squish some air out, but then suck the final air out with the bag already inside your suitcase. You can "massage" the clothes and guide how the bag flattens out for a really efficient use of your suitcase space. The organization you can achieve is really impressive. The bag material and valve is tough enough to not allow any air leaks. The red "glides" they provide make sure the seal is solid and easy to achieve. And the system is simple enough that I suspect that elementary kids or people with lower dexterity could operate it (my teens certainly had no issues packing themselves). After returning home, I folded all the bag along their original fold lines, charged up the "sucky thing" (which still held 75% of it's charge after being used at least 20 times), and tucked it all neatly in our travel drawer, ready for our international trip next month. Great value. High quality. I'd even go so far as to say they're fun to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026
G
Verified Purchase
Gail
Chelsea, US
★★★★★ 5
Travel bags
Size: 12 Combo Travel Size
Perfect packing bags. I’m using them for a trip to Alaska. The pump works easily . I tested them out and the air retention is perfect.? They are not too thick and will not take up space. The material seems like it will hold up without ripping. I will be using them often. They come in different sizes which work perfectly with different items.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
E
Verified Purchase
Eric Hansen
Grantham, US
★★★★★ 5
These are a travel must!
Size: 15 Combo Travel Size
We recently took a trip to Japan and South Korea with our 3 kids, and needed to bring all their clothes for 2 weeks, with as few suitcases as possible. These bags were a life saver! We were able to fit so much more stuff in our suitcases with these bags. I don’t know how we would have brought everything without them. We would have had to bring at least one, probably two suitcases more. Easy to use - the vacuum is compact so you can bring it with you, but super powerful and works quickly. Remember to charge it after you use it for when you pack back up. But, you can manually push out the air as well if you’re in a pinch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
C
Verified Purchase
Cameron Byers
Bozeman, US
★★★★★ 4
More pros than cons, very convenient, but durability is an issue.
Size: 15 Combo Travel Size
Pros: I think that this is a good product. I've had it for several weeks and travel every week for work. It's a good design and the vacuum pump is ergonomic and reliable, in my experience. Charges relatively quickly at home and I'm not sure how long the charge lasts, because it's convenient with a USB-C port, so I charged whenever the charge got to 3 bars. My experience is that dress shirts maintain the pressing if folded and packed neatly. They're creased, but hang them in the hotel bathroom and the steam from a shower loosens the wrinkles nicely. Cons: durability. The bags are pretty thin and after 3 or 4 trips the seal in the bag(s) can become compromised. I suspect the leaks are tiny and in the actual bag vs. the seal. With regular use, this was in only two of the fifteen bags. The double zip lock is really durable. FOR CAMPING: they were great for motorcycle camping, however the durability became an issue. I was camping along a lake and took some care with the bags, but admittedly was a little harder on them than I could have been. I took extra bags just in case, and am glad I did. Three of the 6 bags I took slowly lost the vacuum. If you're using them for camping, pack extras. They're inexpensive enough to continue to buy replacements periodically and you do get a lot. TIPS: pack the vacuum in the suitcase with the bags. Pack the bags with a complete outfit for each day. The temptation is to pack shirts in one bag, socks/underwear in the other, etc. It's more difficult to repack dirty clothes that way, but if you have each day in its own bag you just use each one for a dirty laundry bag.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026

recommand products