SKU: 53247038944

Human ADAM23 Protein, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ADAM23 Protein, His tagProduct Specification Species Human Synonyms Disintegrin and metalloproteinase domain containing protein 23, ADAM 23, Metalloproteinase like, disintegrin like, and cysteine rich protein 3 (MDC 3), MDC3 Accession O75077 Amino Acid Sequence Protein sequence (O75077, Ser60 His585, with C His tag)

Product Specification


Species Human
Synonyms Disintegrin and metalloproteinase domain-containing protein 23, ADAM 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3 (MDC-3), MDC3
Accession O75077
Amino Acid Sequence

Protein sequence (O75077, Ser60-His585, with C-His tag) SRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLH

Expression System HEK293
Molecular Weight Predicted MW: 61.2 kDa (pro) & 34.9 kDa (mature) Observed MW: 40-50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

ADAM23 (A Disintegrin And Metalloproteinase 23) is a member of the ADAM family, known for its roles in cell adhesion and signaling. Unlike other ADAMs, it lacks proteolytic activity but interacts with integrins and extracellular matrix proteins, influencing neuronal development and synaptic plasticity. ADAM23 is highly expressed in the brain and has been linked to epilepsy and neurodegenerative disorders. It also plays a role in cancer progression, where its dysregulation affects tumor cell migration and metastasis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53247038944

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mad Jack
Massapequa, US
★★★★★ 5
Inexpensive walls.
Color: Grey, Size: 34" - 3 Panel, Color: Grey, Size: 34" - 3 Panel
We had a hot request for a workstation in the warehouse with some privacy. These have worked great. Easy to assemble. They are lightweight and stable. This was an inexpensive solution that looks professional. Our client loved it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 1, 2025
A
Verified Purchase
Amber
San Leandro, US
★★★★★ 1
Dont wait! Assemble right away! Just in case you need to return it.
Color: Black, Size: 22" - 4 Panel
Ok, I like the idea of this but the assembly is frustrating. One side lined up perfectly with the holes however, the small bars that connect the screen to base is not lining up. I think it's do the fabric the screen or divider is made of. It's not stretchy. I brought this months ago and just opened it today. I'm upset and don't even think returning it is possible. If the material was a bit longer or stretchy to give a little room to work with this divider would be great. However, I'm not sure what I can use it for since I'm unable to attach it to the bottom. Beware! Don't wait like me. Tip for the manufacturer. Next time invest in Velcro dividers so the fabric can be adjusted with ease. Literally if I take the screen off the frame aligns perfectly. However, it defeats its purpose of privacy. I might buy some material myself and create a more flexible divider. Or I'll buy Velcro myself and attach to the bottom. I don't know yet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025
L
Lorraine
Birmingham, US
★★★★★ 4
Smooth, Stable, and Perfect for Flexible Spaces
Size: 88''W-4 Panel, Color: Grey, Size: 88''W-4 Panel, Color: Grey
This room divider is incredibly easy to move thanks to its industrial-grade silent casters. It glides smoothly across different floor types with just one hand and without any noise, while the built-in wheel locks keep it firmly in place once positioned, no slipping or unwanted movement. The base with reinforced steel feet adds impressive stability, preventing wobbling even in busy or high-traffic areas. I also love the foldable design, which makes storage effortless when it’s not in use. It folds down compactly and fits neatly into small spaces. I gave only 4 stars because I'm not crazy about the color of the fabric. Otherwise this is a very functional way to separate areas.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026
K
K
Louisville, US
★★★★★ 5
easy to put together, stable and blocks out unwanted eyes.
Size: 88''W-4 Panel, Color: Grey
If you live in a high rise building, or where there is lots of foot traffic and can see in your windows, this is a must have. It's portable, can fold down one or two walls and easy to move around. Put together once, and block out light and eyes while tall enough to see over. You can fold it up along the wall, and use it to block out the blinds or light when using a projector so that it's darker. You can use it to partician the room if you share one, and separate your pile of junk from your room so you don't look at it, can take quite a bit of towel weight and clothes and doesn't tip over. Sturdy bottom metal and easy to put together. I got the grey one, and glad I did. I use it everyday and is part of my room decor. I love it, and after using it for a few months it's quite durable. The quality is there for sure. A tad pricey, but worth it. Must have for a private person.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
K
KKat 10
Belleville, US
★★★★★ 5
Well made dividers.
Size: 88''W-4 Panel, Color: Grey
Very durable and stable. Once positioned, they stay upright and firm and don't wobble around. Good materials on both the panels and the frame that supports it. Great for any partitioning needs and a fair price for the quality you receive. Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 28, 2025

recommand products