SKU: 53276774227

Human VEGF 165, His tag

Sale price$128.25 Regular price$142.50
Save 10%

Pay in installments of $35.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 19 - Aug 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VEGF 165, His tagProduct Specification Species Human Synonyms Vascular permeability factor (VPF), VEGF Accession P15692 4 Amino Acid Sequence Protein sequence (P15692 4, Ala27 Arg191, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 20. 9 kDa Observed MW: 25 kDa Purity

Product Specification


Species Human
Synonyms Vascular permeability factor (VPF), VEGF
Accession P15692-4
Amino Acid Sequence

Protein sequence (P15692-4, Ala27-Arg191, with C-10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Predicted MW: 20.9 kDa Observed MW: 25 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Vascular endothelial growth factor (VEGF or VEGF-A) is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the PDGF family. Humans express alternately spliced isoforms of 121, 145, 165, 183, 189, and 206 amino acids (aa) in length. VEGF165 appears to be the most abundant and potent isoform, contains basic heparin-binding regions and is not freely diffusible. VEGF binds the type I transmembrane receptor tyrosine kinases VEGF R1 (also called Flt-1) and VEGF R2 (Flk-1/KDR) on endothelial cells. VEGF165 binds the semaphorin receptor, Neuropilin-1 and promotes complex formation with VEGF R2. VEGF is required during embryogenesis to regulate the proliferation, migration, and survival of endothelial cells. In adults, VEGF functions mainly in wound healing and the female reproductive cycle. Pathologically, it is involved in tumor angiogenesis and vascular leakage. Circulating VEGF levels correlate with disease activity in autoimmune diseases such as rheumatoid arthritis, multiple sclerosis and systemic lupus erythematosus.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53276774227

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
TL
Charlottesville, US
★★★★★ 5
It's Working
Scent: Smoky coffee, Size: 4 Fl Oz (Pack of 1)
I like how it softens and protect hair. I am using sparingly on my scalp and have not used enough to see hair growth yet. I have had it for a month but do not use daily. I am growing my grey hair out and I have noticed that some of the white hairs are more salt and pepper now so it naturally darkens hair. My friend who told me about the product has been using it longer and her grey hairs are pretty much unnoticed by the natural darkening effect, blending enough to give her a light brown look. I have extremely fine thin fragile hair so I leave it on instead of rinsing or washing it out per instructions, that is another reason I do not use daily on hair and scalp. So far I have not had any negative side effects by using sparingly and leaving in until weekly wash. There is a strong smokey smell but not overwhelming for me and the scent dicipates within an hour or less.so I am not bothered by it. After using product on my hair, I rub a little on my nails & cuticles. It appears to help, as my cuticles are a lot healthier now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2024
B
Verified Purchase
Bstew
Los Angeles, US
★★★★★ 4
Ash vs. Moisture/Success?
Scent: Smoky coffee, Size: 4 Fl Oz (Pack of 1)
The product feels great on the skin and moisturizes well. Although, don't be fooled by the smokey coffee detail. I'm an avid expresso bean grinder and drinker, this is no coffee. Smells like strong chain smokers favorite corner of the house on a stressful day. Imagine ash trays and Jojoba blended. Now that that's explained, it genuinely feels great on the skin/beard/scalp. Unfortunately, I am unsure how long my wife will tolerate this as a nighttime routine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 9, 2025
D
Verified Purchase
denise varnell
Pawtucket, US
★★★★★ 5
Strong coffee smell. Might not be be compatible for everyone. However, product is really good.
Scent: Smoky coffee, Size: 4 Fl Oz (Pack of 1)
Love this product. May not be compatible for someone who doesn't like smell of coffee that does not detract from the product. it's really good for hair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2026
N
Verified Purchase
Natalie
Phoenix, US
★★★★★ 3
So far nothing amazing
Scent: Smoky coffee, Size: 4 Fl Oz (Pack of 1)
So I’ve been using for a couple of weeks now and I haven’t noticed any difference. I am going to continue on. I don’t know if it takes time for it to actually show some results. I will say two things about it. It comes solid for 12 my jar cracked and broken And it’s non-returnable so I just have to deal with it so that’s unfortunate after paying $20 second of all it is a solid mass so you have to put it in your hands and kind of warm it up for it to become any sort of an oil and I wouldn’t even consider it an oil at that it’s more of like a cream once you warm it up in your hands, but it doesn’t make your hair greasy. I use a small amount I would think that the jar would last a long time given that you don’t need a lot to get through to your scalp unfortunately, with my jar being cracked, I don’t know how that’s gonna affect the longevity of the product And it does have a smell think of burnt coffee beans that will dissipate after about an hour to an hour and a half after putting it on, but if you’re not putting it on, I’m just going to bed. It might be become an issue. I’m gonna wait it out. I hope I do see results from doing this but again so far nothing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2025
M
Verified Purchase
megan moyes
Pawtucket, US
★★★★★ 5
Wonderful product
Scent: Smoky coffee, Size: 4 Fl Oz (Pack of 1)
I used this on a bald spot I had and it worked extremely well. Consistency is key though it needs to be used every day
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026

recommand products