SKU: 53846806400

Human CD8, hFc tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD8, hFc tagProduct Specification Species Human Synonyms T lymphocyte differentiation antigen T8 Leu 2, MAL Accession P01732 Amino Acid Sequence Protein sequence (P01732, Ser22 Asp182, with C hFc)

Product Specification


Species Human
Synonyms T-lymphocyte differentiation antigen T8/Leu-2, MAL
Accession P01732
Amino Acid Sequence

Protein sequence (P01732, Ser22-Asp182, with C-hFc) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

Predicted MW: 43.7 kDa Observed MW: 55 kDa

Purity >95% by SDS-PAGE
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD8 (cluster of differentiation 8) is a transmembrane glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). Along with the TCR, the CD8 co-receptor plays a role in T cell signaling and aiding with cytotoxic T cell-antigen interactions. Like the TCR, CD8 binds to a major histocompatibility complex (MHC) molecule, but is specific for the MHC class I protein. There are two isoforms of the protein, alpha and beta. The extracellular IgV-like domain of CD8-α interacts with the α3 portion of the Class I MHC molecule. Cytotoxic T cells with CD8 surface protein are called CD8+ T cells. Once the T cell receptor binds its specific antigen Lck phosphorylates the cytoplasmic CD3 and ζ-chains of the TCR complex which initiates a cascade of phosphorylation eventually leading to activation of transcription factors like NFAT, NF-κB, and AP-1 which affect the expression of certain genes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53846806400

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
M
San Leandro, US
★★★★★ 5
Soft and beautiful!
Color: Brown, Size: 60"x80"
Love it! So soft and pretty. A little small for my queen sized bed, I would size up. But beautiful and warm, feels high quality. No shedding.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
W
Verified Purchase
WT
Bozeman, US
★★★★★ 4
DO NOT PUT IN DRYER
Color: Cream&grey, Size: 60"x80"
Very soft, very comfortable, very warm, sheds a lot at first. 9/10 for initial impression. So how do you wash it? The instructions say take it to a professional dry cleaner which costs more than the blanket, so that option is out. I've been looking everywhere and everyone says something different, I've ruined two blankets trying to figure it out how to clean them. DO NOT PUT IN YOUR DRYER WITH HEAT, EVER, PERIOD. I ruined my second blanket by putting it in the dryer for just 7 minutes on 'delicate' heat, just don't do it. Even using no heat in the dryer will cause the material to become slightly more abrasive after each cycle. MACHINELESS AIR DRY ONLY. The faux fur has an insanely low fraying point and even getting it moderately warm causes it to become abrasive and have a harsh tangled 'dog blanket' feel to it that is permanent. COLD WASH ONLY ON DELICATE. This seems to have little to no effect on the quality of the blanket. Use high quality detergent with little to no additives for delicates and a laundry bag. Fabric softeners are a big NO, they will shorten the life of your blanket substantially. For colors, The Cream and Grey and Yellow and Grey are very nice and picture accurate. The Camal was far darker than the images would have you believe and it has a greenish copper tint to it. The Ivory looks awful with how they brushed the tips.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 7, 2025
A
Verified Purchase
Amazon Customer
Belleville, US
★★★★★ 5
My Favorite Blanky
Color: Yellow&grey, Size: 60"x80", Color: Yellow&grey, Size: 60"x80"
The color of the yellow/grey is exceptional. The blending and pattern of the two colors makes for a very realistic looking pelt and the colors go with an extensive variety of other colors you may have in your home. In a couple of spots you could see little clumps where the fur was sticking out further than the rest, almost like it was trying to shed, but I just took scissors and cut the little tuffs to be even with the rest of the fur. Never once has it actually shed. It holds smells really well so washing it on a delicate cycle with those scent booster beads and then putting it in the dryer on the Air Dry setting creates this magical scent that fills an entire room. I have issues with a lot of textures so I’m very particular about my fabrics and furs and I can tell you this blanket feels like pure bliss and does not give me sensory overload or an icky feeling. It’s a great weight as well, id say it’s a medium-heavy blanket. It’s exactly what I was looking for. I have had this blanket for about a year now and the quality is definitely worth it. It’s held up against 3 big dogs, my toddler, and my newborn and it still looks like it just got delivered to me. Personally I thought the blanket was going to be bigger, but I am still content with the size. it’s gone from my couch to my bed and fits both perfectly. I love it on both. I feel that for the price the blanket could have been bigger but other than that, it was worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 5, 2024
A
Verified Purchase
Angela
Fort Morgan, US
★★★★★ 5
Recommend
Color: White & Black, Size: 60"x80"
Very nice appaearance, soft, and large enough for cozy winter nights. No shedding that I can tell. Happy with purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
G
Verified Purchase
Gary
Lexington, US
★★★★★ 5
Quality look. Quality feel
Color: Brown, Size: 60"x80"
Excellent product. Feels and looks like real fur. Color is fantastic and realistic. Good weight feel and very warm. You won't be disappointed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026

recommand products