SKU: 54325598075

FABP6 His Tag, Human

Sale price$193.50 Regular price$215.00
Save 10%

Pay in installments of $53.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP6 His Tag, HumanProduct Specification Species Human Synonyms ILeal Lipid binding protein Accession P51161 Amino Acid Sequence Met1 Ala128, with N terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms ILeal Lipid-binding protein
Accession P51161
Amino Acid Sequence Met1-Ala128, with N-terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

FABP6(ILeal Lipid-binding protein, ILBP) is a cytoplasm protein which belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It binds mainly to bile acids that are reabsorbed in the ileum. Thus, mice lacking FABP6 do not exhibit a fatty acid metabolic phenotype but are protected against gallstone disease. FABP6 is a cancer-related protein that acts as an intracellular transporter of bile acid in the ileal epithelium. FABP6 may also play an important role in early carcinogenesis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54325598075

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Natasha Spencer
San Leandro, US
★★★★★ 3
Cheap
Size: 6FT*6FT, Color: Black
They serve their purpose as long as you leve them in one place and not moving them around and they're kinda flimsy and some of the velcros are cut too short and can't stay closed
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
R
Verified Purchase
Robin Q
Fort Morgan, US
★★★★★ 5
Excellent separation screen
Color: Dark Black
Easy to put together. A drill with the hex head made it easier. I see some of the photos in the reviews and it looks like the fabric is wrinkled and loose. However, when we put it together, the fabric was tight and it looked polished. Using this divider to separate a recording space from the rest of the room the overall look is nice. I would not use this in a living room, but it’s fine in another room. Once put together, it is pretty sturdy. The pieces that connect the panels together are plastic. We did fold it one time when we moved it and didn’t have any issues, but it is going to remain stationary so I can’t comment on folding it more than the one time. It is very lightweight and very opaque.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026
S
Verified Purchase
Shane O'Daniel
Phoenix, US
★★★★★ 1
JUNK!
Color: Grey
This is the worst product in every way. I ordered a similar one previously and thought I was getting the same product which was great, no this is a piece of junk. I would have gladly sent it back but I needed it. I feel sorry for anyone who tries to put this together without any mechanical ability. I have plenty and it was still a nightmare. We will surely not be purchasing anything from this company in the future. The previous one I bought was a (Kecreque Room Divider). Is is a quality product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
F
Verified Purchase
Foxcat
Boise, US
★★★★★ 5
Nice looking and lightweight
I bought this to put in front of my basement doorway where I am missing a door. I don't like my cats in the basement and this works very well. However, because of the panels being up on 2 inch or so tiny stilts, my cats can still get through. So I have it upside down and will be putting gliders on the "bottom" of each panel. Note that it did come with gliders on the little stilts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2023
K
Verified Purchase
Karl S.
Port Orchard, US
★★★★★ 5
Easy privacy
Color: Grey
Great divider for a great price! Creates perfect portable privacy for the bed in our den.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 9, 2026

recommand products