SKU: 54334243887

IL-3 Rα/CD123 Fc Chimera Protein, Mouse

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-3 Rα/CD123 Fc Chimera Protein, MouseProduct Specification Species Mouse Accession P26952 1 Amino Acid Sequence Ser17 Lys331, with C terminal Human IgG1 Fc

Product Specification


Species Mouse
Accession P26952-1
Amino Acid Sequence Ser17-Lys331, with C-terminal Human IgG1 Fc SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 80-91kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Interleukin 3 receptor alpha (low affinity) (IL3RA), also known as CD123 (Cluster of Differentiation 123) is a 45-62kDa glycoprotein member of the hematopoietin receptor superfamily. This protein associates with a beta subunit common to the receptors for IL-5 and granulocyte-macrophage colony-stimulating factor (GM-CSF) to form a high-affinity receptor for IL-3. The interleukin-3 receptor α chain (CD123) has been identified as a potential immunotherapeutic target because it is overexpressed in AML compared with normal hematopoietic stem cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54334243887

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
phan_graph
Lake Worth, US
★★★★★ 4
Great buy
Color: Blue+Red
My dogs kill every toy. They arrived very agressive chewers. These have lasted way longer than most balls have. Great value
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
M
Verified Purchase
megs2168
San Leandro, US
★★★★★ 5
If your dog loves tennis balls, you NEED these
Color: Azure+Orange, Color: Azure+Orange
Raising any puppy is tough. Raising a German Shepherd puppy has often left me questioning my life choices. So I was ecstatic the day that my 60-lb puppy decided that he loves tennis balls and occupied himself for 2 hours without needing constant intervention. Naturally, my immediate response was to make sure we had a constant supply of large tennis balls for dogs available. Now my puppy loves mischief, but he’s not an aggressive chewer. And I was irritated to discover that every brand and size of tennis ball broke within an hour max of play. By simply playing fetch and batting the ball around with his paws, every single tennis ball split into 2 halves. We needed something better! These squeaky balls are exactly that! They come in a 2-pack. I gave my pup the 1st one a week ago and it’s still going strong! We play fetch in the backyard, he brings it into the doggy pool with him, it rolls around in the dirt and can be rinsed off easily. It’s by far his favorite toy, and he takes it everywhere with him. Finally a squeaky ball that can keep up with my dog! These are the perfect size, texture, bounce, squeak, everything. These are the ONLY squeaky balls I will buy from now on. Five stars for sure!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
B
Verified Purchase
Brad
Grantham, US
★★★★★ 5
Really are indestructible. Amazing product.
Color: Blue+Red
Wow! Really indestructible. Our large dogs have destroyed other “indestructible” toys in less than an hour and these are amazing. They squeak, which our dogs love (we hate) and they float when they go into our pool. IF they ever do wear out or are lost I will definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
K
Verified Purchase
Kelsey
Alexandria, US
★★★★★ 5
Durable squeaky ball for chewers
Color: Blue+Red, Color: Blue+Red
These are great! My 54 lb GSP loves them and it’s the only thing she cannot destroy! She’s currently 1 year and we have had the balls for several months. We have this brand and similar ones too. They float, bounce, and squeak. The ridges are good for chewing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
S
Verified Purchase
Stephanie Dutey
Charlottesville, US
★★★★★ 5
Finally a Toy My Pitbull Hasn’t Destroyed in 5 Minutes
Color: Blue+Red, Color: Blue+Red
I have a 65 lb pitbull who destroys most toys almost immediately, so I’m always skeptical when products claim to be “indestructible.” Most toys last maybe a few minutes in my house before pieces are everywhere. These have actually held up surprisingly well. The material feels durable and thick enough to handle really aggressive chewing, and so far my dog hasn’t been able to destroy them like he does with most other balls and squeaky toys. That alone makes these worth it to me. I also really like the size. They’re large enough that I don’t have to constantly worry about him accidentally swallowing them or choking while playing, which is a huge plus for bigger dogs. The squeaker inside also keeps him interested longer since he usually gets bored quickly with toys that don’t make noise or bounce around well. If you have a strong chewer or larger dog and you’re tired of replacing destroyed toys constantly, these are definitely worth trying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026

recommand products