SKU: 54581556646

Staphylococcus aureus Protein A (B), His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Staphylococcus aureus Protein A (B), His tagProduct Specification Species Staphylococcus aureus Synonyms IgG binding protein A, Staphylococcal protein A (SpA), spa Accession P02976 Amino Acid Sequence Protein sequence (P02976, Met212 Lys269, with C His tag) MADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK Expression System E. coli Molecular Weight Predicted MW: 8. 4 kDa Observed MW: 8. 4 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Tag with C His tag Physical Appearance Lyophilized

Product Specification


Species Staphylococcus aureus
Synonyms IgG-binding protein A, Staphylococcal protein A (SpA), spa
Accession P02976
Amino Acid Sequence

Protein sequence (P02976, Met212-Lys269, with C-His tag) MADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK

Expression System E.coli
Molecular Weight Predicted MW: 8.4 kDa Observed MW: 8.4 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Protein A is a 42 kDa surface protein originally found in the cell wall of the bacteria Staphylococcus aureus. It is encoded by the spa gene and its regulation is controlled by DNA topology, cellular osmolarity, and a two-component system called ArlS-ArlR. It has found use in biochemical research because of its ability to bind immunoglobulins. It is composed of five homologous Ig-binding domains that fold into a three-helix bundle. Each domain is able to bind proteins from many mammalian species, most notably IgGs. It binds the heavy chain within the Fc region of most immunoglobulins and also within the Fab region in the case of the human VH3 family. Through these interactions in serum, where IgG molecules are bound in the wrong orientation (in relation to normal antibody function), the bacteria disrupts opsonization and phagocytosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54581556646

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gigi
Charlottesville, US
★★★★★ 4
Good but confusing instructions
It is very glowy. After spraying this on my husband commented on why I was sweating so much 😹 I told him it’s my face mist spf. I have very dry and very sensitive skin and this has not broken me out (yet). I’ve used it for about a week now. I don’t know how much sun protection I’m really getting though. And reapplying it all through out the day, esp in the summer will lead to very very oily looking skin. It’s also confusing because it says do not spray directly onto face. (?) I just hold my breath and close my eyes tightly before I put my mascara on and spray this. So far it’s been helpful with not making my make up look cakey. There is a smell but it’s not a bad smell, slightly fruity and the smell of spf. If you are sensitive to smells this might not be for you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2025
R
Verified Purchase
richelle daugherty
Lowell, US
★★★★★ 5
Wonderful!
Item Package Quantity: 1
This makes your skin glow. Smells amazing. I’m older and in my 50s and it is great sun coverage and brightener. I will 100% keep using this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
A
Verified Purchase
Arin Bizzarri
West Palm Beach, US
★★★★★ 5
Great sun protection!
Sun protection factor: 50 Sun Protection Factor (SPF), Size: 6 Ounce (Pack of 2)
My favorite summer sunscreen protection for myself and my kiddos! Smells good and does what it says. Kids are in and out of the water and mom basks in the sun so it protects us all!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
T
Verified Purchase
T. Johnson
Alexandria, US
★★★★★ 5
Great sunscreen brand
Sun protection factor: 30 Sun Protection Factor (SPF), Size: 3 Fl Oz (Pack of 2)
We love this brand. It provides the sun protection we are looking for. Easy to apply and it has a pleasant scent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
D
Verified Purchase
Dayra Gonzalez
Belleville, US
★★★★★ 5
smells fresh without being overpowering
Sun protection factor: 30 Sun Protection Factor (SPF), Size: 6 Fl Oz (Pack of 1)
The spray makes it SO easy to apply, especially when you’re in a rush. No white cast, no heavy feeling—just a quick mist and you’re good to go.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026

recommand products