SKU: 55792063690

Human FGL1, hFc tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FGL1, hFc tagProduct Specification Species Human Synonyms Fibrinogen like protein 1, HP 041, Hepassocin (HPS), Hepatocyte derived fibrinogen related protein 1 (HFREP 1), Liver fibrinogen related protein 1 (LFIRE 1), HFREP1 Accession Q08830 Amino Acid Sequence Protein sequence (Q08830, Leu23 Ile312, with C hFc tag)

Product Specification


Species Human
Synonyms Fibrinogen-like protein 1, HP-041, Hepassocin (HPS), Hepatocyte-derived fibrinogen-related protein 1 (HFREP-1), Liver fibrinogen-related protein 1 (LFIRE-1), HFREP1
Accession Q08830
Amino Acid Sequence

Protein sequence (Q08830, Leu23-Ile312, with C-hFc tag) LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Expression System HEK293
Molecular Weight

Predicted MW: 60.1 kDa Observed MW: 60 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Fibrinogen-like protein 1 (FGL-1) is a protein that is structurally related to fibrinogen. In humans, FGL-1 is encoded by the FGL1 gene. Four splice variants exist for this gene. FGL1 is a member of the fibrinogen family of proteins, which also includes fibrinogen, fibrinogen-like protein 2, and clotting factors V, VIII, and XIII. FGL-1 is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of that are common to all members of the fibrinogen family. However, FGL-1 lacks the platelet-binding site, cross-linking region, and thrombin-sensitive site which allow the other members of the fibrinogen family to aid in fibrin clot formation. FGL-1 has also been observed to strongly bind to and activate LAG-3, a regulatory protein expressed on T cells. As LAG-3 has an important role in controlling activated T cells, manipulating FGL-1 binding to T cells has been proposed for both cancer immunotherapy and anti-inflammatory treatments.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 55792063690

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Becky
Grantham, US
★★★★★ 5
Work well on hubby's heals
Color: Gray
Dr recommended these for hubby's dry cracked heals
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
M
Verified Purchase
Misha
Grantham, US
★★★★★ 3
Ehh. Not for me.
Color: Gray
Foot slides when walking in them. The fit was tighter than lead to believe. It did hold the moisture in but the silicone patch is small
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
B
Verified Purchase
Bonnie
Lake Worth, US
★★★★★ 5
Is this the CURE!
Size: Regular, Color: Cream
I have a skin disease called Ichthyosis Vulgaris. Yes, SCALEY FISH! Thanks MOM! This unfortunate crud leaves my heels an embarrassing mess! They are cracked and dry and literally like concrete. I have had this disease all my life and there is NO cure. It's hideous! Anyway, I have tried so many different experiments to help improve my situation. So much time and money I will never get back. So when I saw these, I had to give them a try too because I am a forever optimist and love being disappointed. Here's how it went. First I put my dermatologist recommended AmLactin on my crusty heels. Then, I put the socks on. By the way, with no problem at all, and went to bed. I was not too hot, which is usually what happens when I sleep with socks on. I never even realized that I had them on. When I woke up, I took them off and immediately used a "Heel File" over a towel removing all the yuck!. Then, I sand papered them to smooth the skin out. Then, I doused them with Shea and Aloe foot lotion I found at the bottom of my experiment drawer in my bathroom. Oh, they felt like someone else's feet. I am very hopeful at this moment! Is this the cure to my embarrassing situation? I sure hope so. Spring is here and I would really like to wear my cute flip-flops when I go to the Waffle House and set at the bar. Wasn't that a picture on Facebook of someone nasty heels? It made me gag. Then, I had to make sure that picture wasn't me! I am going to do this for a week and come back for another review. Wish me luck ya'll! UPDATE! So it’s been about two weeks. I wish that I had taken a before and after picture. I guess I figure that this too will be a waste of money. NO! These little socks are a God send for me. I did buy AmLactin foot repair cream and that I highly recommend. It’s the best so far. They also offer an option with heel socks. They are soft and work very well also but one negative. They leave fuzzies on you feet and tools. Guys this is it for me. My search is over! I went to my mani/pedi queen yesterday and she was shocked when she saw my feet. She is spreading the word!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2025
C
Verified Purchase
Crowder
Charlottesville, US
★★★★★ 5
Great reusable moisturizing
Size: Regular, Color: Cream
Love these! Use them often to help moisturize my heels with my favorite moisturizer. Comfortable and easy to use
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
H
Verified Purchase
Heather
Grantham, US
★★★★★ 5
Buy these!
Size: Regular, Color: Cream
I only write a review when I have a strong opinion and want to help others decide. I've been having trouble with cracked heels for months. Previously I had just been using regular socks, but these slip-ons have been game changers! They don't make my feet hot at night. They are comfortable and in the morning my heels feel soft, and I don't need to use them everyday. They look good and fit well even if I want to wear them under socks or in shoes during the day. They really do help if you have cracked heels along with some kind of lotion. Definitely effective!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2025

recommand products