SKU: 55878219770

IL-15R alpha/CD215 Fc Chimera Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 7 - Aug 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-15R alpha/CD215 Fc Chimera Protein, HumanProduct Specification Species Human Antigen IL 15R alpha CD215 Synonyms IL 15RA, IL 15R alpha, Interleukin 15 Receptor Subunit Alpha, CD215 Accession Q13261 Amino Acid Sequence Ile31 Thr205, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen IL-15R alpha/CD215
Synonyms IL-15RA, IL-15R-alpha, Interleukin-15 Receptor Subunit Alpha, CD215
Accession Q13261
Amino Acid Sequence

Ile31-Thr205, with C-terminal Human IgG1 Fc ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

75-80kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Perrier C. et al. (2013) Interleukin-15 receptor α expression in inflammatory bowel disease patients before and after normalization of inflammation with infliximab. Immunology. 138(1): 47-56.

Background

IL-15Ra chain is expressed by many cell types including monocytes, dendritic cells, natural killer cells, T cells and fibroblasts. Several isoforms of IL-15Ra exist and are generated either by alternative splicing or by proteolytic cleavage. Hence, IL-15Ra can be found as a membrane receptor or as a soluble receptor (sIL-15Ra); and as most isoforms of the receptor contain a sushi domain allowing very-high-affinity binding of IL-15, signaling or regulatory functions can be attributed to the receptor. Competition between soluble and membrane receptors can result in reduced biological activity of IL-15, though a super agonist effect of the soluble form was also observed. The signaling of IL-15 appears more complicated than for other cytokines because IL-15 primarily exists as a complex bound to IL-15Ra. When IL-15/IL-15Ra complexes are shuttled to the cell surface, they can stimulate opposing cells through the b/cC receptor complex (trans-presentation), or alternatively may allow an autocrine stimulation (cis-presentation).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 55878219770

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
S. Phillips
Draper, US
★★★★★ 4
Good quality but it was slightly longer than original and needed modification.
Style: BE-182 1-Pack
Bought this cabin filter for a 2023 Acura TLX. While the filter seems to be made of quality material, it was just a little too long (about a 1/16 of an inch, so I had to trim it to make it fit so the cover would fit snug. I was able to do that without compromising the filter itself. But this might be an issue for some people
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
K
Verified Purchase
Keith Granholm
Battle Creek, US
★★★★★ 5
Fits my Chevy 2021 Bolt Premier perfectly.
Style: BE-966 1-Pack
Installation was a breeze, fir nicely and the air in teh car now smells fresh and clean. The old filter has developed a musty smell so this new one is great. Had it replaced in under 3 minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
P
Verified Purchase
Punkizback
Chelsea, US
★★★★★ 5
Fits perfectly for my 2017 VW Passat
Style: BE-373 1-Pack, Style: BE-373 1-Pack
Bought this for a fraction of the cost. An auto shop wanted to charge me $72.99 for a filter so I bought this Spearhead brand cabin filter and its the perfect size and its just as sturdy as the previous one the dealership had in the car. Not sure yet how the airflow is or if anything different as I have not driven in the car since it was replaced, but it appears to be a very high quality cabin filter for my car at a great price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
S
Verified Purchase
SBJ
Pawtucket, US
★★★★★ 5
Good Quality Replacement for Lexus
Style: BE-285 1-Pack
Was a perfect fit for my 2016 Lexus NX200t. No tools required. Total of 5 minutes to install. Airflow is good after replacement and the activated charcoal seems to make a difference in reducing any smells from outside. Recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
K
Verified Purchase
KK
San Leandro, US
★★★★★ 5
Economical, easy to install, and does the job!
Style: BE-182 1-Pack
First, depending on your car model, replacing your cabin air filter is VERY easy. With that out of the way, the shop wanted to charge almost 65 dollars to replace my cabin air filter. Decided to just buy one and do it myself. The only downside of waiting is that the air inside the car is not as fresh/clean when you're running your air. Anyways, you can usually get these kinds of filters between 20-45 dollars from auto part shops depending on the brand and features. I've used this brand and filter for the past 3 replacements on my car and they last just as long and filter just as well from my experience. No issues installing, and does in fact do a good job of filtering outside odors. Highly recommended for the price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026

recommand products