SKU: 57177759171

LILRA3 His Tag Protein, Human

Sale price$306.00 Regular price$340.00
Save 10%

Pay in installments of $85.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA3 His Tag Protein, HumanProduct Specification Species Human Synonyms Leukocyte immunoglobulin like receptor subfamily A member 3 Accession Q8N6C8 Amino Acid Sequence Gly24 Glu439, with C terminal 8*His

Product Specification


Species Human
Synonyms Leukocyte immunoglobulin-like receptor subfamily A member 3
Accession Q8N6C8
Amino Acid Sequence Gly24-Glu439, with C-terminal 8*His GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 68-75kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3) is also known as CD85 antigen-like family member E (CD85e), immunoglobulin-like transcript 6 (ILT-6) belongs to a family of leucocyte receptors. LILRA3 lacks a transmembrane domain and it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. The biologic role of the LILRA3 molecule and the nature of its ligand are not known. LILRA3 can bind with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes. It can be detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung. LILRA3 transcripts are markedly upregulated in neutrophils from patients with antiphospholipid syndrome (APS). Some polymorphisms of the LILR genes are reported to be associated with susceptibility to diseases such as rheumatoid arthritis and multiple sclerosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57177759171

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
shannon
Phoenix, US
★★★★★ 5
Great for heavy chewers
Color: Hambone Super Chewer, Size: M/L
Our dog is a hard core chewer! This toy is very durable. Even the covering has lasted. We assumed we would need to take the cover off right away but it’s still going after 3 months. It’s definitely chew resistant
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
J
Verified Purchase
JJ
Massapequa, US
★★★★★ 4
Great treat dispenser
Color: Hambone Super Chewer, Size: M/L
Great rubber toy, the outside fabric did not last long, so glad that it is a treat holder/dispenser otherwise it would have been done for in about 10min. The opening for the treats is pretty small so can only fight thinner broken up treats. Great for larger dog that likes to dissect her toys, keeping her entertained longer and no fluff all over the house
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2025
B
Verified Purchase
Bethany Messner
Grantham, US
★★★★★ 5
My dog loves this toy!
Color: Hambone Super Chewer, Size: M/L, Color: Hambone Super Chewer, Size: M/L
My dog LOVES this toy. It is so cute. It was a little smaller than I thought it would be, but it’s actually the perfect size for him. He carries it everywhere with him, and if he happens to have forgotten it, we say “go get your pig” and you can see it click in his head that he forgot it, and he runs to get it. He loves to drop it to make it bounce. He is 9, he used to instantly rip anything to shreds, but he seems to have gotten a little more delicate in his older age and after a few weeks hasn’t gotten through to the harder toy yet. Once this toy bites the dust, we will have to buy him another because of how much he loves his pig.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
J
Verified Purchase
Jessica
Whiting, US
★★★★★ 3
Not a Good Choice for Chewers
Color: Get Ripped Margrrrita, Size: L
I loved the idea of this toy, but it did not work or last as intended. It is pretty heavy and made of thick rubber. The flaps over the cup where the treats are dispensed did not last 5 minutes with my pup, so we can no longer use it to dispense treats/use as a brain game.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
A
Verified Purchase
Amber
Louisville, US
★★★★★ 5
Super fun, my dog loves it!
Color: Hambone Super Chewer, Size: M/L
I adopted a Feist/Pit mix and this was the first toy I got him for just him. He went nuts for it! He’s a destructive pup so ripping the soft “skin” off of hambone really helped him release some pent up energy! Now he carries it around in the yard and just chews on it. If you have tiny treats, drop em in the nose holes and watch your pup go crazy trying to get them out!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products