SKU: 57783255321

Human CD34, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD34, hFc tagProduct Specification Species Human Accession P28906 Amino Acid Sequence Protein sequence(P28906, Ser32 Thr290, with C hFc)

Product Specification


Species Human
Accession P28906
Amino Acid Sequence

Protein sequence(P28906, Ser32-Thr290, with C-hFc) SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:53.5 kDa Actual:115 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD34 is a transmembrane phosphoglycoprotein protein encoded by the CD34 gene in humans, mice, rats and other species. CD34 derives its name from the cluster of differentiation protocol that identifies cell surface antigens. CD34 was first described on hematopoietic stem cells independently by Civin et al. and Tindle et al. as a cell surface glycoprotein and functions as a cell-cell adhesion factor. It may also mediate the attachment of hematopoietic stem cells to bone marrow extracellular matrix or directly to stromal cells. Clinically, it is associated with the selection and enrichment of hematopoietic stem cells for bone marrow transplants.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57783255321

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
J
Port Orchard, US
★★★★★ 5
Former lib. Book
Format: Hardcover
Book was as described
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 18, 2023
D
Verified Purchase
Deb from Bushville
Whiting, US
★★★★★ 5
Carry on with the great writing Rachel Lacey while I look for my next bodyguard book
Format: Kindle
I'm on a bodyguard reading kick right now, only wlw of course. I read this one for the first time about a year ago and somehow, I didn't leave a review. ( I'm good at hopping from one book to another and forgetting to write one. oopsy) I loved the bodyguard part but as stories go I always hate someone's parent dying. ( too much like real life) I know it's necessary to show why Natalie is so effed up. Rachel wrote a great ending to this story and that is always a plus in my eyes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
H
Verified Purchase
hannah kriner
Omaha, US
★★★★★ 4
cute and captivating
Format: Kindle
I really enjoyed the storyline and the emotional growth of the characters in this book. I’d been putting it off for a while but I’m glad I finally picked it up and took a chance on it because it was such a cute story.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 24, 2025
S
Verified Purchase
Soft-Hearted Scribbler
Whiting, US
★★★★★ 5
Romance, Steam, and Angst!
Format: Kindle
When successful movie star Natalie Keane hires Taylor Vaughn to be her bodyguard and fake girlfriend, it doesn't take long for their pretend attraction to spark very real feelings, but with both women deeply scarred by the past, is a Hollywood-style happy ending possible? Strictly speaking, Cover Story is a celebrity romance. Natalie Keane is a successful film actress whose career is at a high point thanks to a recent Golden Globe nomination. She has an entourage and even lives in a large house that boasts its own observatory with a telescope. But that being said, this is not the glitzy, glamourous, escapist story some readers might associate with the celebrity romance trope. While she may be a powerful star to the outside world, internally, Natalie is quiet, introspective, and perpetually haunted by a traumatic incident from her past. Her carefully insulated world is an extension of the emotional barriers she's built around her heart. Enter Taylor Vaughn, the sexy, competent bodyguard Natalie hires to pose as her girlfriend while providing extra security. On the surface, she's the perfect heroine to rescue the reclusive Natalie, all while their attraction sizzles to the point of combusting. But Taylor has vulnerabilities and self-doubts too, and the closer she gets to Natalie, the more she risks pushing past her own physical and emotional limitations. Cover Story has plenty of Hollywood excitement, including red carpet interviews and movie stunts. And there is no shortage of romance or heat between Natalie and Taylor, but what really gives the story impact is the poignant and authentic journeys of heart and mind that the characters take separately and together. The journeys are not straightforward, but ultimately, they highlight the power of healing, taking risks, and finding a person to feel safe with. If you enjoy sapphic stories with romance, steam, but also a healthy dose of angst and authenticity, you'll be captivated by Cover Story.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2024
R
Verified Purchase
Roxanne Belen
Draper, US
★★★★★ 5
Great read! 5 stars
Format: Paperback
This is such a great read! I love how vulnerable Nath is towards Taylor. It feels so loving....
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026

recommand products