Pay in installments of $75.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD63 His Tag Protein, HumanProduct Specification Species Human Antigen CD63 Synonyms LAMP 3, MLA1, TSPAN30 Accession P08962 Amino Acid Sequence Ala103 Val203, with C terminal 8*His AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGS Expression System HEK293 Molecular Weight 20 31kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7.
Product Specification
| Species | Human |
| Antigen | CD63 |
| Synonyms | LAMP-3, MLA1, TSPAN30 |
| Accession | P08962 |
| Amino Acid Sequence | Ala103-Val203, with C-terminal 8*His AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGS |
| Expression System | HEK293 |
| Molecular Weight | 20-31kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1． Sònia Tugues. Tetraspanin CD63 Promotes Vascular Endothelial Growth Factor Receptor 2-β1 Integrin Complex Formation, Thereby Regulating Activation and Downstream Signaling in Endothelial Cells in Vitro and in Vivo. 2． J Biol Chem 2013 Jun28;288(26):19060-71. Epub 2013 Apr 30. |
Background
CD63 is a member of the transmembrane-4 glycoprotein superfamily, known as tetraspanins. The tetraspanins contain four transmembrane domains, two extracellular loops flanked by short intracellular N and C termini, and a highly conserved sequence motif within the larger extracellular domain. Tetraspanins interact among themselves and with other transmembrane proteins to form membrane domains denoted tetraspanin-enriched microdomains (TEMs). At least in part through the TEMs, tetraspanins regulate a variety of cellular processes including cell fusion, intracellular trafficking, cell adhesion, motility, invasion, and cell differentiation. CD63 is among the most highly expressed tetraspanins in endothelial cells (ECs). Still, the role of CD63 in endothelial biology and angiogenesis remains to be addressed. We show that CD63 is co-localized with the type I integral lysosomal membrane protein (LAMP-1) but also present on the EC surface. By silencing CD63 expression in primary ECs, we demonstrate that CD63 associated with both β1 integrin and VEGFR2 in the plasma membrane and was required for VEGFR2-β1 integrin complex formation. Loss of CD63 expression disrupted downstream signaling path ways both in endothelial cells in culture and in intact tissues. As a consequence, CD63-deficient ECs failed to engage in sprouting angiogenesis and organize into tube structures.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy