Pay in installments of $31.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 12 - Aug 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Cystatin-C His Tag, HumanProduct Specification Species Human Synonyms Cystatin CCystatin CCystatin 3CST3 Accession P01034 Amino Acid Sequence Ser27 Ala146, with N 6*His MHHHHHHDDDDKSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Expression System E. coli Molecular Weight 14. 9 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder
Product Specification
| Species | Human |
| Synonyms | Cystatin-C，Cystatin C，Cystatin-3，CST3 |
| Accession | P01034 |
| Amino Acid Sequence | Ser27-Ala146, with N-6*His MHHHHHHDDDDKSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA |
| Expression System | E.coli |
| Molecular Weight | 14.9 kDa(Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <2EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Human cystatin C (hCC) belongs to a family of proteins called cystatins. There are three distinct types of cystatins that share sequence and structure homology but differ in size, site of action, and disulfide bond topology. Human cystatin C belongs to the type 2 cystatins that are generally secreted as extracellular polypeptides. hCC is broadly distributed and found in most body fluids. This small protein consists of 120 amino acids forming a single polypeptide chain. Cystatin C contains four conserved cysteine residues that can form two disulfide bonds but, unlike other family members, was neither shown to be glycosylated (cystatin E/M and cystatin F) nor phosphorylated (chicken cystatin). Furthermore, hCC can be found in monomer, dimer, oligomer, and fibril states.
In terms of biological function, hCC is a target of proteolysis, and primarily functions as a protease inhibitor. It is degraded by cathepsin D and elastase.Uncontrolled proteolysis leads to an imbalance between active proteases and endogenous inhibitors,eventually leading to disease.The hCC concentration in blood correlates with the glomerular filtration rate(GFR), an important marker of kidney health and the progression of diabetes, chronic kidney disease.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy