SKU: 60088507120

Human MIF, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MIF, His tagProduct Specification Species Human Synonyms Glycosylation inhibiting factor (GIF), L dopachrome isomerase, L dopachrome tautomerase (EC: 5. 3. 3. 12), Phenylpyruvate tautomerase, GLIF, MMIF Accession P14174 Amino Acid Sequence Protein sequence (P14174, Pro2 Ala115, with C 10*His) PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFAGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight

Product Specification


Species Human
Synonyms Glycosylation-inhibiting factor (GIF), L-dopachrome isomerase, L-dopachrome tautomerase (EC:5.3.3.12), Phenylpyruvate tautomerase, GLIF, MMIF
Accession P14174
Amino Acid Sequence

Protein sequence (P14174, Pro2-Ala115, with C-10*His) PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFAGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 14.2 kDa Observed MW: 12 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Macrophage migration inhibitory factor (MIF) is a protein that in humans is encoded by the MIF gene. MIF is an important regulator of innate immunity. The MIF protein superfamily also includes a second member with functionally related properties, the D-dopachrome tautomerase (D-DT). CD74 is a surface receptor for MIF. Bacterial antigens stimulate white blood cells to release MIF into the blood stream. The circulating MIF binds to CD74 on other immune cells to trigger an acute immune response. Hence, MIF is classified as an inflammatory cytokine. Glucocorticoids stimulate white blood cells to release MIF and hence MIF partially counteracts the inhibitory effects that glucocorticoids have on the immune system. Trauma activates the anterior pituitary gland to release MIF.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 60088507120

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
GG
Chelsea, US
★★★★★ 1
Ruined by Reformulation
New formula update: They ruined this product by reformulating. Used to be so hydrating, long-lasting, and the only thing that gave me relief from eczema. Now it is somehow SO drying, oily, and all around terrible. Judging by reviews here and on their website many customers are unhappy with the change. Done with Avene. Original five star review: This is a great all around lip balm, but if you struggle with perioral dermatitis/eczema then you NEED this. If I'm experiencing a flare, I slather on cicalfate+ at night but I can't exactly walk around with that during the day which is where this lip product comes in. It is calming, hydrating, and long-lasting. I have gone through more tubes than I can count. This was my first time ordering through amazon and I am happy to report I received authentic Avene.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2022
B
Verified Purchase
BlackHeartNY
Draper, US
★★★★★ 5
It’s a God Send
I had a rash all around my lips and my lips got extremely dried out and started to peel. I used Avene Cicalfate Restorative Lip Cream and it really soothed my lips with the moisture they needed, and you don’t need to use a lot of this product. I plan on buying this again. Just wish the tube was bigger! I use other Avene products and I’m extremely happy with them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
C
Verified Purchase
candi muncy
Omaha, US
★★★★★ 5
Great for post microneedling or tattoos
Size: 1.3 Fl Oz (Pack of 1)
Great for skin after microneedling. Keeps skin feeling smooth, non-greasy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
Y
Verified Purchase
Yo-Landa
Alexandria, US
★★★★★ 5
Good on my Melanated skin
Size: 1.3 Fl Oz (Pack of 1)
Lovely, just wish it was bigger or cheaper but I love it and will buy again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2026
F
Verified Purchase
Francophile
Houston, US
★★★★★ 5
Feels good on the skin not greasy
Size: 1.3 Fl Oz (Pack of 1)
Very nice product very concentrated has a very light fragrance that dissipates very quickly not greasy. No I do not have any redness or sensitivity I wanted to try this product anyway because I'm always looking for moderately priced good quality that travels well. And this fit the bill especially with it being on sale.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2026

recommand products