SKU: 60607598047

USP36 Protein

Sale price$466.20 Regular price$518.00
Save 10%

Pay in installments of $129.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

USP36 ProteinProduct Specification Species Human Synonyms UBP36, KIAA1453USP36 Accession Q9P275 Amino Acid Sequence A81 I461

Product Specification


Species Human
Synonyms UBP36, KIAA1453,USP36
Accession Q9P275
Amino Acid Sequence

A81-I461

ARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRVGAGLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGI

Expression System E.coli
Molecular Weight

68.9 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 60607598047

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mary Rosaso
New York, US
★★★★★ 5
Beautiful Art and Great Insight for All Fans
Format: Hardcover
I'm a huge fan of the series. Not just for the story, character depth or enticing music.. but the art. It's what hooked me the first episode I saw. I mean, c'mon, you can't deny how gorgeous the premiere looked! So yes, I JUMPED at the opportunity to grab a copy of this baby. The cover is quality. Then you open up to the map of the Avatar world followed by an introduction given by M. Night... And then, the revealings of Avatar's beginnings come to light. One of the things I have to stress about this book is the amount of insight about the behind the scenes work. For the fans who want to know how this deep story came to light, they tell you and they don't hold back. Everything from insights on the difference between American Animation studios and Asian Animation studios to momo going from a robotic monkey to a lemur explained.. It's really great and helped me appreciate the show a lot more. This makes up the first of five chapters. After this, it comes on to highlight sketches from each episode in chapters made up of each season. Some explained in depth, such as "Jet" and "The Blue Spirit" and others just illustrations with very minimal explanation, such as "The Deserter". (Season one). They include small extras about the DVD covers and the chibi Avatar animations as well. The artwork is beautifully colored and high quality ensured. It looks absolutely great. My only nitpick about the book is how short it feels. At times, I wanted more artwork and more details, or wanted some of the art featured to be larger so I can gasp at the details. All in all though, this book really shows how much thought, love and care was put in and the vast amount of talent of those who worked on it. Boy do they have talent. The art speaks for itself. Even friends who aren't fans of the show loved looking through the book. A must buy for any fan or anyone interested in this line of work for that matter. Go! Buy it! The Avatar will blow you away! Eh heh...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2012
Z
Verified Purchase
Zackattack
Pawtucket, US
★★★★★ 5
Best Supplemental Book EVER!
Format: Hardcover
This is probably the best Avatar related product I ever bought apart from the three seasons that comprise the series. The book details everything you would want to hear about especially if you are interested in "Behind the Scenes" things like I am. This book details pretty much the entire production process. It features how Bending was inspired, early character designs, story ideas, even how they came up with the hybrid animals. I love how the creators talk about each character, and every single episode is talked about in this book, even if they only take a page to talk about. This book impressed me beyond words. I loved each page, each drawing, some of the early work on Iroh looks really cool. If you are a fan of the animated series this will make a phenomenal addition to your collection of Avatar related memorabilia. It's a wonderful book and I plan to read it many more times. If I could put one criticism to this book it would be that there is no explanation of where Zuko's mom went but I can live with that until the next comic book comes out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2012
K
Verified Purchase
Kindle Customer
Carnegie, US
★★★★★ 5
Gorgeous.
Format: Hardcover
This artbook is utterly beautiful. When I first tore open the box and laid my eyes upon the product, I literally gasped in amazement. After watching The Last Airbender movie, simply thinking about Avatar filled my body with disgust and made my gag reflex quite sensitive. I couldn't even watch the show without having terrifying flashbacks of the disgraceful film. Thankfully, looking at this book reopened my eyes to the sheer brilliance of the true series. Every single word written in this book is basically pie for an avatard like me. Bottom line: I ate it all up. And I loved it. This book is filled with details about the series, how the makers came up with their ideas, what inspired them, and so much more. What REALLY put the icing on the cake is the artwork (duh h4x0rzzzzz, it's an artbook). Every little pencil sketch, drawing, painting, left me in awe. So stunning! Most of the time when I buy books, I'll read/look at them once or twice and then it spends the rest of its book-life sitting on my bookshelf, collecting book-dust. I can guarantee you that this is a treasure that won't have the opportunity to sit still. Definitely worth the buy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 15, 2010
S
Verified Purchase
Spyctre
Waukegan, US
★★★★★ 5
Must Have for All Fans!
Format: Hardcover
This book is wonderful! If you are a fan of the show, it is indeed a "must have." As an artist, I was also hoping for a lot of character designs so I could have accuracy if I decided to make some fanart, and this is chock full of character designs. It has every last costume each main character or secondary character wore as well as designs for all of the people you see milling about the background of the episodes. There are beautiful samples of environments, building designs, and production artwork as well, and many humorous little notes jotted here and there next to the art. There are even images of the Wanted Posters and a certain Waterbending Scroll. ;) They go into detail about the creations of the characters, go over episodes, and give you a lot of fun trivia to know. So if you are an artist also looking for some reference material(this had all I was hoping for and tons more) or you just want a ton of fun facts and nice images to look at, you will not be disappointed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2010
B
Verified Purchase
Bianca
Lexington, US
★★★★★ 5
You get more than what you paid for.
Format: Hardcover
This extensive book is a must not only for fans of the animated series but for anyone with an appreciation for artistic practices. The skill and time dedicated into creating the animated series is well reflected in this journal, with an excellent layout and beautiful page spreads of conceptual arts not only is it a must have item, it contains very informative accompanying text that give a real background on the design and development of the project. The pages are thick and good quality with a glossy finish and the hardback cover will take a beating, (although this is a book you will want to preserve for a long time to come, i wouldnt recommend throwing it under a truck)It is clear that the developers of this series are passionate about their work and are enthusiastic in sharing their journey with you. The sketches and conceptual arts, designs and architecture drawings are of a quality and uniqueness you will not find else ware and the character development sections really discussed in depth the motivations and inspirations for their creation. This book is an inspirational read for anyone and well worth more than the cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2012

recommand products