SKU: 6200682664

Human ANGPT2 Protein, His tag

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ANGPT2 Protein, His tagProduct Specification Species Human Synonyms Angiopoietin 2, ANG 2 Accession O15123 Amino Acid Sequence Protein sequence (O15123, Asp68 Phe496, with C His tag)

Product Specification


Species Human
Synonyms Angiopoietin-2, ANG-2
Accession O15123
Amino Acid Sequence

Protein sequence (O15123, Asp68-Phe496, with C-His tag) DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Expression System HEK293
Molecular Weight

Predicted MW: 51 kDa Observed MW: 72 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Angiopoietin - 2 (ANGPT2) is a significant protein in the angiopoietin family. It plays a crucial role in angiogenesis, the process of new blood vessel formation. ANGPT2 is produced by endothelial cells and acts as a key regulator in vascular remodeling. Functionally, ANGPT2 binds to the Tie2 receptor on endothelial cells. In the presence of vascular endothelial growth factor (VEGF), ANGPT2 promotes endothelial cell destabilization, leading to increased vascular permeability and facilitating angiogenesis. However, in the absence of VEGF, it can cause vessel regression. Abnormal levels of ANGPT2 have been linked to various pathological conditions. In cancer, elevated ANGPT2 often correlates with tumor angiogenesis and metastasis, as tumors rely on new blood vessels for growth and spread. Additionally, it is involved in inflammatory diseases and eye disorders related to abnormal blood vessel growth, making it an important target for research into novel therapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 6200682664

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Steven
Carnegie, US
★★★★★ 5
A Fun and Engaging Playtime Essential for Active Dogs
Size: 18in, Style: Sport
The ChuckIt! Sport 18M Dog Ball Launcher has been a game-changer in our playtime routine with our energetic and playful dog. This innovative and well-designed ball launcher has become an essential tool to keep our furry friend entertained and active. The 18" length of the launcher provides a comfortable grip for both me and my dog during play. It allows for effortless throwing, making fetch games enjoyable for both of us. The launcher's ergonomic design ensures a smooth and efficient ball-throwing experience, saving me from straining my arm during extended play sessions. The inclusion of a medium-sized ball (2.5") with the launcher is a thoughtful addition. The ball's size and weight are perfect for our medium-sized dog (20-60 pounds), allowing her to easily grab and carry it in her mouth. The ball is also durable and can withstand the enthusiastic chewing of our playful pup. One of the standout features of the ChuckIt! Sport 18M Dog Ball Launcher is its exceptional throwing distance. It allows us to launch the ball far into the distance, providing ample space for our dog to run and fetch. This extended range adds a fun and challenging element to our playtime, keeping our dog engaged and excited. The durable construction of the launcher is commendable. It has proven to withstand rigorous use and outdoor play, making it a reliable and long-lasting investment for our dog's entertainment. Additionally, the launcher's compatibility with other ChuckIt! balls makes it a versatile tool for various play styles and preferences. Whether it's a bouncy rubber ball or a flying disc, the launcher can handle them all. Moreover, using the ChuckIt! Sport 18M Dog Ball Launcher has strengthened the bond between our family and our dog. It encourages interactive play, providing an opportunity for us to engage and connect with our furry companion while promoting exercise and healthy physical activity. In conclusion, the ChuckIt! Sport 18M Dog Ball Launcher has been an absolute joy for our family and our playful dog. Its easy-to-use design, impressive throwing distance, and durability make it a must-have for any dog owner with an active and fetch-loving pet. We highly recommend the ChuckIt! Sport 18M Dog Ball Launcher, along with the included medium ball, for a fun-filled and active playtime experience that both you and your dog will love.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 3, 2023
A
Verified Purchase
Another Floyd
San Leandro, US
★★★★★ 5
Essential kit for those with fetch dogs
Size: 18in, Style: Sport
Now in our 3rd year, my Brittany and I are down to about 40 fetch tosses a day, some 14,600 tosses a year. The Chuck It launcher wears well, so, figure at least 5 years of use, for 73,000 tosses. That makes for a terrific value! There are several key benefits of the Chuck It launchers: One is that you can chuck the ball further than you can throw, which allows you to exercise your dog more easily. The second is that you can pick up and launch the ball without touching it, which means NO slime! And, the Chuck It also gives extra reach when you have to retrieve a ball from sticker brambles. Those are great features for anyone with a fetch dog. If you also happen to have a weak arm or shoulder, the Chuck It launchers provide nice throwing options. I generally throw underhanded. I can't get the full potential range, that way, but, I still get good, long tosses. I curl my second finger above the last bump on the handle, and use a good wrist flick along with arm swing. I've seen others throw side-arm with the Chuck It. I had originally written a second review for the longer 25M Chuck It. Either I, or Amazon messed up, and it looks like I can have only this one review. So, here are my additional thoughts on the 25M: I bought the 25M so that I could throw the ball even further! The good news is, you really can chuck further, with the longer chucker. The bad news is, those longer throws do require more arm and shoulder strength than when using the 18M. This becomes more obvious when you've done 3 or 4 dozen throws. I would recommend the 25M only for those with the youth and/or strength to get the most out of it. Otherwise, I'd say, go with the 18M.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2016
C
Verified Purchase
charles jensen
Alexandria, US
★★★★★ 4
Will buy again
Size: 25in, Style: Sport
Fits the bill.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2025
L
Verified Purchase
Liz H.
Dallas, US
★★★★★ 5
Must Have for Tiring Out Your Pup
Size: 25in, Style: Sport
The Chuckit! Sport 25M Dog Ball Launcher is an absolute must-have for any dog owner with an active pup! This thing takes fetch to a whole new level—effortless long throws, hands-free pickup (no more slobbery tennis balls!), and a comfortable grip that makes playtime easier and way more fun. My dog absolutely loves it, and I love that it helps her burn off energy without tiring out my arm. The included medium ball is the perfect size for medium to large dogs, and the durable construction means it's built to last. If you're looking for a simple but game-changing way to upgrade fetch, this is it. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2025
A
Verified Purchase
Ann
Chelsea, US
★★★★★ 5
My Niece dog loves it!
Size: 18in, Style: Sport
This ball launcher takes a bit of getting. used to, but it is really helpful for those of us who are not MLB pitchers! The launcher itself is a sturdy plastic that is not brittle yet not soft; when the ball is launched there is no destructive bending in the shaft. The handle is padded and ergonomically sound while the cup end cradles the ball but has cut-outs on each side for easy loading and unloading of the ball. It did take a bit of practice for me to get the hang of it, but for my husband and son it was much easier. The launcher works well to help us older, non-gifted athletes launch the ball farther and faster while saving the shoulder, elbow, and wrist (important if there is any arthritis). The ball fits nicely into the cup and releases easily. The 2.5 size was too small for my Doberman, so we opted for the 3.5 in launcher. This smaller launcher and ball are now in the employ of my sister and her husband for their retriever-border collie mix, an 18 month old little fireball!. This is just the right size for her. My sister's husband has difficulty with arthritis and is neither quick on his feet nor able to stand very long. So the launcher comes in very handy. He can actually sit in a lawn chair and throw the ball repeatedly when their dog retrieves and returns it to him. That is a win- win! Top 3 Likes: -Easy to use -Helps older pet owner -Drives the ball farther and faster Top 3 Dislikes: -With repeated uses the edges of the launcher appear to get scuffed and scratched -Some ingrained staining on the edges persists requiring scrubbing to remove -There is a mild worry that with time the launcher may snap
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2024

recommand products