SKU: 62261185973

NKp30/CD337 Fc Chimera Protein, Cynomolgus

Sale price$198.00 Regular price$220.00
Save 10%

Pay in installments of $55.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

NKp30/CD337 Fc Chimera Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms Natural killer protein 30,NCR3,CD337 Amino Acid Sequence Leu19 Gly137, with C terminal human IgG1 Fc

Product Specification


Species Cynomolgus
Synonyms Natural killer protein 30,NCR3,CD337
Amino Acid Sequence Leu19-Gly137, with C-terminal human IgG1 Fc LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLGAGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 50-60 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62261185973

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Trouble In FL
Grantham, US
★★★★★ 5
Fantastic writing and non-stop action
Format: Kindle
This is a promising, fantastic beginning to what will be a 4-book series. Some readers may be content to read only the first 2 books, but I think you'll find that the story is so good that you'll want to keep reading books 3 and 4. Book 1 is about omega Elvana's introduction to the "Starling" brothers and their search for another missing person, Kelly. It's a bit of a rocky start, with deception and betrayal a key element. Hardly an auspicious beginning. Each member has their own path and purpose in the pack. Their interactions and the resulting narrative are so well-written that I found it difficult to put down. There is a cliffhanger that will have you reaching for book 2 as you finish, so make sure you have it on hand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2023
R
Verified Purchase
rilakk
Los Angeles, US
★★★★★ 4
Fun read
Format: Kindle
I'm not really into mafia books but I love Roxy Collin's other series so I decided to give it a try. It had the same great romance, spice, swoon-worthy characters and exciting plot that are her signature. Arben was my favorite, although it was a bit sudden how quickly he changed from ignoring her to wanting to be pack. There were almost too many twists/layers of lies to keep track of but I'm looking forward to reading the other books. The only thing that detracted from the story for me was the need for a bit more proofreading. It was mentioned that Kelly is a female and male at different points, leading me to think she changed her mind at some point about the character's gender but didn't go back and edit it to align in all places. Like another reviewer pointed out, step siblings are different than half siblings. They are incorrectly referred to as step siblings because they (allegedly) share the same biological dad. There are a few other typos as well but those aren't a big deal.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2025
C
Verified Purchase
Carmen Alicea
Los Angeles, US
★★★★★ 5
Stepbrothers, Secrets, and Sizzling Heat
Format: Kindle
Twisted Lies by Roxy Collins is a wild ride through family secrets, amnesia, and a steamy stepbrother romance. When Kelly discovers her life is built on lies, she ends up tangled with three alpha stepbrothers and an assassin who once helped her through a heat. The tension? Off the charts! The heat is real, and the complications are messy in the best way. Full of twists, secrets, and fated mates? You'll be hooked from page one! Love omegaverse drama with a dash of taboo? This one's for you!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 10, 2024
A
Verified Purchase
Ashley
Port Orchard, US
★★★★★ 3
Good read
Format: Kindle
The book has some good twists and turns, but truthfully I was so confused on some things. It didn't have a good flow for me personally. Not sure if it's due to typos or using him/her wrongly, but I thought Kelly was both a guy and a girl. Actually I still don't know, and it made me incredibly frustrated. It would refer to Kelley as him or he, and then again in another part of the story as her she and sister. On to the next book, I hope there is some clarity and a smoother flow. This is a slow burn, and I just don't know how much I care for the Alphas yet. Idk if I recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2023
S
Verified Purchase
75_SweetestBook
Massapequa, US
★★★★★ 5
the lies
Format: Kindle
This is amazing fast pace read that is full of plot twists and lies that keep getting bad. This is a story we’re a omega has been lied to by her mother and finds out that someone is slowing dieing. 3 alpha take the omega and feed her more lies so they can use her against her father so they can find their mate Kelly. This is a dark read and ends in a cliffhanger and so good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2023

recommand products