SKU: 6228330320

Mouse CD19, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 1 - Aug 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD19, His tagProduct Specification Species Mouse Synonyms B lymphocyte antigen CD19, Differentiation antigen CD19 Accession P25918 Amino Acid Sequence Protein sequence (P25918, Arg19 Gly287, with C His tag)

Product Specification


Species Mouse
Synonyms B-lymphocyte antigen CD19, Differentiation antigen CD19
Accession P25918
Amino Acid Sequence

Protein sequence (P25918, Arg19-Gly287, with C-His tag) RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Expression System HEK293
Molecular Weight Predicted MW: 31.3 kDa Observed MW: 45-60 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

B-lymphocyte antigen CD19, also known as CD19 molecule (Cluster of Differentiation 19), B-Lymphocyte Surface Antigen B4, T-Cell Surface Antigen Leu-12 and CVID3 is a transmembrane protein. CD19 is expressed in all B lineage cells. CD19 plays two major roles in B cells: on the one hand, it acts as an adaptor protein to recruit cytoplasmic signaling proteins to the membrane; on the other, it works within the CD19/CD21 complex to decrease the threshold for B cell receptor signaling pathways. Due to its presence on all B cells, it is a biomarker for B lymphocyte development, lymphoma diagnosis and can be utilized as a target for leukemia immunotherapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 6228330320

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Roscoe and Tori
Massapequa, US
★★★★★ 5
DIY!!
Bought this cabin air filter for my 2015 Honda CR-V and it fit perfectly. Installation was super easy and only took a few minutes. I immediately noticed the air coming through the vents smelled cleaner. No need to have it replaced for you. Definitely worth it if you want an affordable replacement that gets the job done.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
B
Verified Purchase
Ben W.
Draper, US
★★★★★ 5
Perfect replacement
Perfect replacement for our 2016 Acura RDX. Easy to install.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
H
Verified Purchase
H.Tran
Houston, US
★★★★★ 5
Impressive Air Quality Upgrade
I recently upgraded my 2019 Honda Civic with the A-Premium Cabin Air Filter with Activated Carbon, and I couldn't be more thrilled with the results. This cabin air filter offers exceptional value for money, proving that you don't have to break the bank for improved air quality inside your car. Installing the A-Premium Cabin Air Filter was a breeze. It fit perfectly into my Honda Civic's existing filter slot, and the installation process was straightforward, even for someone with limited automotive knowledge. The filter's precise dimensions and design made it a seamless replacement, saving me time and effort. The included instructions were clear and concise, further simplifying the installation process. The activated carbon feature of this cabin air filter is truly remarkable. It works wonders in improving the air quality inside the car's cabin by effectively trapping and neutralizing odors, pollutants, and allergens. I immediately noticed a significant difference after installing the A-Premium filter. The cabin air felt fresher, and I could breathe easier knowing that the filter was efficiently removing harmful particles and unpleasant smells. Considering the affordability of this product and the tangible benefits it provides, the A-Premium Cabin Air Filter with Activated Carbon is an excellent investment. It delivers on its promise to enhance the air quality inside your vehicle, making your driving experience more comfortable and enjoyable. If you're seeking an affordable yet effective cabin air filter upgrade for your 2019 Honda Civic, I highly recommend the A-Premium Cabin Air Filter with Activated Carbon. Its exceptional value for money, ease of installation, and remarkable impact on air quality make it a standout choice that won't disappoint. Upgrade your driving environment today and experience the difference for yourself.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 25, 2023
R
Verified Purchase
R J
Alexandria, US
★★★★★ 4
2015 Civic
Size fits properly on a 2015 Honda Civic SI sedan. Price could be a little cheaper for a non-OEM part.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
J
Verified Purchase
Jean Therasse
Phoenix, US
★★★★★ 5
Excellent fit and great quality”
This filter fit perfectly and was very easy to install. The quality feels solid, and it made an immediate difference in air flow. It’s a reliable replacement at a much better price than the dealer. I’ll definitely be buying this brand again for future changes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 17, 2025

recommand products