SKU: 63322014740

Human IL-1beta, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-1beta, His tagProduct Specification Species Human Synonyms Catabolin, IL1F2 Accession P01584 Amino Acid Sequence Protein sequence (P01584, Ala117 Ser269, with C 10*His) APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Predicted MW: 19. 0 kDa Observed MW: 19, 23 kDa Purity 90% by SDS PAGE Endotoxin <1EU g

Product Specification


Species Human
Synonyms Catabolin, IL1F2
Accession P01584
Amino Acid Sequence

Protein sequence (P01584, Ala117-Ser269, with C-10*His) APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Predicted MW: 19.0 kDa Observed MW: 19, 23 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin-1 beta (IL-1β) also known as leukocytic pyrogen, leukocytic endogenous mediator, mononuclear cell factor, lymphocyte activating factor and other names, is a cytokine protein that in humans is encoded by the IL1B gene. IL-1β is a member of the interleukin 1 family of cytokines. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. Increased production of IL-1β causes a number of different autoinflammatory syndromes, most notably the monogenic conditions referred to as Cryopyrin-Associated Periodic Syndromes (CAPS), due to mutations in the inflammasome receptor NLRP3 which triggers processing of IL-1B.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 63322014740

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
A c
West Palm Beach, US
★★★★★ 5
Perfect and easy to splice buy durable.
Size: 100-Foot, Style: 14-Gauge
Used for home audio setup. Klipsch speakers to Denon receiver. Could've wired directly but chose to add the plug ins for connecting. Sound quality is amazing. Perfect gauge and high quality strands. Easy to work with amd splice when needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
J
Verified Purchase
Joshua
Cuba, US
★★★★★ 5
Excellent Quality Speaker Wire for A Great Price!
Size: 100-Foot, Style: 14-Gauge
I recently purchased the Amazon Basics 14-Gauge Audio Speaker Wire Cable in the 100-foot length. Let me share my thoughts on this product: Quality: The cable is made of 99.9% oxygen-free copper, which ensures high-quality, undistorted signals. I noticed a significant improvement in sound clarity compared to my previous wire. Durability: The insulated exterior jacket is both strong and flexible, making it easy to route the wire around corners or through tight spaces. It feels robust and well-constructed. Color Coding: The red and black color coding simplifies polarity identification during installation. No more guessing which wire goes where! Convenience: With 100 feet of cable, I had plenty of length to connect my speakers to the A/V receiver without any issues. It’s convenient for larger rooms or setups. Price: At $35.90 (only $0.36 per foot), this speaker wire offers excellent value for its quality. Plus, it’s eligible for free returns within 30 days. In summary, the Amazon Basics 14-Gauge Audio Speaker Wire Cable is a reliable choice for anyone setting up a home theater system or connecting speakers. Whether you’re an audio enthusiast or just want clear sound, this cable won’t disappoint. Highly recommended! Comparison with Similar Items: If you’re looking for an alternative, consider the Monoprice Access Series 14 Gauge AWG CL2 Rated 4 Conductor Speaker Wire/Cable. It’s fire safety rated for in-wall use and comes in a 250-foot length. Remember, good speaker wire can make a noticeable difference in your audio setup!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2024
W
Verified Purchase
Will
Grantham, US
★★★★★ 4
Solid Value 14 AWG Cable, but Jacket Design Could Be Improved
Size: 200-Foot, Style: 14-Gauge
This Amazon Basics 14-gauge speaker wire gets the job done at a very competitive price—under $0.15 per foot for the 200-foot spool. I’m using it for my surround sound speakers, and electrically, it performs just fine for that purpose. Whether it’s truly 99.9% oxygen-free copper (OFC) is hard to verify, but for my needs, it works well. One major downside is the non-round cable jacket design. There are no internal fillers to keep the wire shape consistent, which makes stripping the outer jacket more difficult than it needs to be. Because of the uneven shape, it’s easy to accidentally nick or cut the insulation on the conductors inside while trying to strip it. Including fillers or a more robust outer jacket would make this product significantly better. On the plus side, the cable has printed numbering along one conductor, which makes it easier to measure and cut lengths accurately—definitely a helpful touch for multi-speaker setups. In short, this is a cost-effective solution for basic speaker wiring, but the cable construction could be improved to make handling and prep easier. Still, for the price, it’s hard to complain too much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2025
C
Verified Purchase
Christine Menees
Battle Creek, US
★★★★★ 5
Gets the job done
Size: 200-Foot, Style: 14-Gauge
Very sturdy with excellent sheathing protection/durability. Great value for the linear ft available. Paired with Amazon basic banana plugs for excellent speaker wire
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
R
Verified Purchase
Rich Kirchner
Lowell, US
★★★★★ 5
Durable Speaker Wire
Size: 100-Foot, Style: 14-Gauge
Durable and difficult (good thing) to strip off the outer sleeve. Very good speaker wire.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products