SKU: 65229846937

Human IL-25, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-25, His tagProduct Specification Species Human Synonyms Interleukin 17E (IL 17E), IL17E Accession Q9H293 Amino Acid Sequence Protein sequence(Q9H293, Tyr33 Gly177, with C 10*His) YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMGGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 18. 4 kDa Actual: 20, 23, 27 kDa Purity 95% by SDS PAGE Endotoxin <1EU

Product Specification


Species Human
Synonyms Interleukin-17E (IL-17E), IL17E
Accession Q9H293
Amino Acid Sequence

Protein sequence(Q9H293, Tyr33-Gly177, with C-10*His) YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:18.4 kDa Actual:20, 23, 27 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-25 (IL-25) – also known as interleukin-17E (IL-17E) – is a protein that in humans is encoded by the IL25 gene on chromosome 14. IL-25 is produced by many cell types. This cytokine can induce NF-κB activation, and stimulate the production of IL-8 (named also CXCL8), which is the major chemotactic substance of neutrophils. Another important function of interleukin 25 is to support the Th2 immune response. IL-25 has been shown to induce the production of IL-4, IL-5 and IL-13. Because IL-25 promotes the development of a Th2 immune response, it acts to protect against several bowel infections caused by helminths. IL-25 is also referred to as the regulator of IL-9 production. Another function of IL-25 is the activation of natural lymphoid cells 2 (ILC2).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65229846937

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bethalyn
Dallas, US
★★★★★ 5
Fantastic for rough chewing
Color: Bule 0, Size: For Larege Dogs
Our big boy is rough with his toys and always seems to disintegrate his toys in seconds. I had seen this with hoping this will be the toy he doesn’t destroy. On day 2 now with the toy and he’s obsessed, even feel asleep with the toy in his mouth and still in one piece. Highly recommended for tough chewers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
N
Verified Purchase
Nani
Draper, US
★★★★★ 3
Good but not for my dog
Color: A Red, Size: For Larege Dogs
Dog loves it but already falling apart. Can't seem to find a truly safe dog toy that won't come apart with my aggressive chewer. Had to toss it before pieces got ingested. But great toy in the begining. Just not safe for pit/staff type dog that destroy and chew.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
M
Verified Purchase
Mayberry mommy
Louisville, US
★★★★★ 5
Put your aggressive Chewer dog to the test!
Color: A Red, Size: For Larege Dogs
A very tough toy to stand up to my aggressive chewer lab! It's a great value! The squeak is not annoying, and she's got to clamp down hard on it. It's a nice throw toy! It bounces once or twice but it still brings out the pup in our Dog! Not too small a nice size for a Lab or retriever
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
M
Verified Purchase
Mo
Phoenix, US
★★★★★ 5
A Hardy Toy for Chewers
Color: Bule Octopus, Size: For Larege Dogs, Color: Bule Octopus, Size: For Larege Dogs
I must say I was very surprised with the durability of this toy. We've had it for 3 days and not one puncture hole. My rescue is a destroy chewer that doesn't care for Hardy chew toys unless it squeaks. While the squeaker isn't the best, he still loves it. We put peanut butter in the grooves for him and he goes to town. Will purchase again should he ever destroys it, worth the price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
J
Verified Purchase
Jeffrey Brown
Carnegie, US
★★★★★ 5
Durable toy for a great price! Will buy again.
Color: A Red, Size: For Larege Dogs, Color: A Red, Size: For Larege Dogs
Great toy, heavy, good size, and durable for active chewers. My two dogs like to play tug a war a lot and this toy has held up fantastically! Afterwards they tend to chew toys to pieces but this one has stood the test of time so far. Great buy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products