Pay in installments of $105.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
ATG4B His Tag Protein, HumanProduct Specification Species Human Synonyms ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353 Accession Q9Y4P1 Amino Acid Sequence Met1 Leu393, with N terminal 8*His
Product Specification
| Species | Human |
| Synonyms | ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353 |
| Accession | Q9Y4P1 |
| Amino Acid Sequence | Met1-Leu393, with N-terminal 8*His HHHHHHHHMDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL |
| Expression System | E.coli |
| Molecular Weight | 45kDa |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Zheng X. et al. (2020) The protease activity of human ATG4B is regulated by reversible oxidative modification. Autophagy. 16(10): 1838-1850. |
Background
Initiation and development of autophagy is modulated by several autophagy-related (ATG) genes, which have been identified in yeast and human. Autophagy begins with the formation and maturation of the double-membraned autophagosomes which engulf and deliver cargoes to lysosomes for degradation. The assembling process of autophagosomes is mediated by a family of core ATG proteins, including two ubiquitin-like systems. First, inactive precursor MAP1LC3/LC3 is cleaved by protease ATG4B at the conserved C-terminal glycine residue. After a set of transfer and activation by ATG7, ATG3 and ATG12-ATG5-ATG16L1, the processed LC3 (LC3-I) finally conjugates with phosphatidylethanolamine (PE) at the exposed glycine site via a covalent bond. So far, lipidated LC3, called LC3-II, has become a biomarker of autophagy because of its characteristic of anchoring into the autophagosome membrane. Upon fusion with lysosomes, ATG4B can, in turn, deconjugate LC3-PE to release LC3-I to the cytoplasm for reuse. Hence, ATG4B serves as a priming and delipidation enzyme whose fine regulation is essential for autophagy process.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 28 reviews
Sort
Product Reviews
★★★★★ 5
High quality toy loved by my dogs
Color: Brown, Pattern Name: Tree stump 2 Pack
These are amazing, my dogs favorite toys now. I have two strong chewers who haven’t been able to destroy these. I use yogurt, peanut butter and eggs, broth, really any dog friendly liquids to fill it. I recommend these to all my friends and family with dogs of all sizes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
★★★★★ 5
Excellent Purchase!
Color: Brown, Pattern Name: Tree stump 2 Pack, Color: Brown, Pattern Name: Tree stump 2 Pack
My dogs and I really like these treat toys! I was surprised and questioning whether to keep them when I took them from the box. They are heavier and harder and larger than I envisioned. I didn't realize how hard a nylon/coffee wood combo actually is. However, I want to emphasize that the sales description IS accurate. It details the specifications, materials and size. Clearly states that they are designed specifically for aggressive chewers. I just haven't purchased anything quite like this before.
That said, I was happy it came in a 2 pack and it seems a good value for the price. The dogs have chewed on them, I can see the marks, but they haven't made a dent after about 6 treat sessions. These logs are at least as hard as antlers. They will last a long time. The silicone trays are easy to fill and freeze. I made low calorie popsicles with bone broth and some added mix-ins like pureed pumpkin, healthy freeze dried dog food topper sprinkle, etc. You could also add some peanut butter in the small open end of the log if you want. I just ran hot water over the bottom of the silicone tray to melt the freeze slightly and the frozen treats slid right out. They are shaped perfectly to fit the hole in the log. The seller provided small tools to unscrew/screw the cap in and out for filling with treats.
Even the smaller of my 2 dogs (30 lb Brittany) can get her mouth around the end of the log to carry it to her bed to lay and lick/chew it. I guess another advantage, beyond the durability, of the material is that my dogs don't want to play with it like a toy. They know it is time to relax and have a treat timeout. More like chilling with a chew bone.
Overall we really do love these!! Glad I tried them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026
★★★★★ 5
Durable, Engaging Toy That Actually Lasts
Color: Brown, Pattern Name: Tree stump 2 Pack
I’m really impressed with the ClariVora 2 Pack Dog Toys for aggressive chewers. My dog is a strong chewer and usually destroys toys quickly, but these have held up really well. The material is durable and tough without being too hard, which gives me peace of mind.
I especially love that they can be used as frozen treat toys. Filling them and freezing them keeps my dog busy for a long time and really helps with boredom and anxiety. They’re perfect for extending playtime and keeping dogs mentally engaged.
These toys are a great size for medium to large dogs, easy to clean, and have already become a favorite in our house. If you have a power chewer and want something interactive and long-lasting, I definitely recommend these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2025
★★★★★ 5
Small but aggressive chewers love these
Color: Brown, Pattern Name: Tree stump 2 Pack
I have a Jack Russell and a chihuahua/jack mix (I know, I must have done something really bad in a former life and this is my punishment). They’re both aggressive chewers for their size. These hold up well and they love them. The silicon molds are really easy to use and clean. I spread a little peanut butter around the sides and then fill with wet food, pumpkin, Greek yogurt etc. Once frozen they pop out easy. Keep the kids busy for a solid 20mins. Just don’t over-tighten when you close them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
★★★★★ 5
Amazing durable product for your fur babies!
Color: Brown, Pattern Name: Tree stump 2 Pack, Color: Brown, Pattern Name: Tree stump 2 Pack
We love this product! I have two aggressive chewers, one being a Staffordshire bull terrier, and the other great Dane mix puppy who is eight months old. They both love to chew and can be mischievous or anxiety ridden when they are bored and if they aren’t entertained with something. My Staffordshire bullterrier is a very aggressive chewer and we’ve had a hard time finding durable toys for her. This product is amazing. It keeps them entertained for at least an hour with the food that you can place inside. The molds are great and it’s really nice that I can make homemade dog treats to put in the toy. I use these toys every day, multiple times a day, and they’re holding up amazing. I love that the company includes the molds for the treats as well as a little key to open up the back of the toy to put the food in. This is a really good product. I have spent hundreds of dollars on toys and this one is worth the cost. I’ve tried bully box, Kong products, anything you can think of that says durability chewing, however this is really really good. I 100% recommend this product and I think it’s very fair pricing. Your fur babies will get a lot of playtime with this!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 20, 2025