SKU: 6628397135

Human CD40, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD40, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 5, B cell surface antigen CD40, Bp50, CDw40, CD40L receptor Accession P25942 Amino Acid Sequence Protein sequence (P25942, Glu21 Arg193, with C 10*His) EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGGSHHHHHHHHHH Expression System

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CDw40, CD40L receptor
Accession P25942
Amino Acid Sequence

Protein sequence (P25942, Glu21-Arg193, with C-10*His) EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21.1 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD40 is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of CD40 and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with CD40 and serves as a mediator of the signal transduction. The interaction of CD40 and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Moreover, CD40 molecule is a potential target for cancer immunotherapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 6628397135

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Grady c.
Cuba, US
★★★★★ 3
Bite proof
Color: Blue & Red
The ball is tough but it will not take the dog having it all the time .play with them and put it up or it will not last price not bad
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
J
Verified Purchase
Joe
Omaha, US
★★★★★ 4
Definitely tough but not enough
Color: Black & Lake Blue, Color: Black & Lake Blue
I've been searching high and low for a durable and engaging toy for my 90lb american bulldog. She's destroyed countless toys and her number of toys just keep rising. This lasted for a few hours before she was able to chew off the rubber shell. But now shes still enjoying the hard plastic ball on the inside. Its also a perfect size of ball for her as she can fit it in her jaws comfortably without any worry of he swallowing it. Wish the outside shell was more durable though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
C
Verified Purchase
cw
Draper, US
★★★★★ 5
Large ball, still makes noise and hasn’t chewed it up yet.
Color: Black & Lake Blue
He loves playing with it and it actually doesn’t get swallowed up in his very large mouth. He can still bark talk with it in his mouth which is impressive due to its larger than a softball. It nice because I don’t feel like I’m shoving my hand in his mouth to get it out which baseball size or smaller things I do. He hasn’t chewed it up like he does other squeak toys and it makes lots of noise when tossed and bouncing. It’s hard and he insists on playing with it. we broke a pot when we accidentally hit the pot with the ball. He is always bringing me toys to throw down the hall as we watch tv. I’m like no not that one get a different one. I’m afraid I’ll break something with that one due to how heavy and large it is. That one is an outside toy, he still brings me this one daily and we’ve had it for several weeks now. Plus my cousin little boy just visited and he loved playing with it too. Its made out of material that’s easy to clean for the 17month old to play with in his play pen. It’s not so heavy you can’t throw it just heavier than the others I’m willing to toss down the hall.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
T
Verified Purchase
TIINSAT
Houston, US
★★★★★ 5
Great dog toy
Color: Black & Yellow
Such fun toy. Excellent product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
A
Verified Purchase
Andrew Szeszycki
West Palm Beach, US
★★★★★ 2
Not a chew toy.
Color: Black & Lake Blue
The inside it a hard plastic, my dog can’t chew it. Plastic on the outside is very durable, my dog likes the noise it makes and will chase it but loses interest fast. I will not buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026

recommand products