SKU: 66500586971

Human TMEM119, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 20 - Aug 25

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TMEM119, His tagProduct Specification Species Human Synonyms Osteoblast induction factor (OBIF) Accession Q4V9L6 Amino Acid Sequence Protein sequence (Q4V9L6, Thr118 Val283, with C 10*His) TRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPSVGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 19. 1 kDa Observed MW: 30 kDa Purity 90% by

Product Specification


Species Human
Synonyms Osteoblast induction factor (OBIF)
Accession Q4V9L6
Amino Acid Sequence

Protein sequence (Q4V9L6, Thr118-Val283, with C-10*His) TRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPSVGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 19.1 kDa Observed MW: 30 kDa
Purity >90% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

TMEM119 is known as a microglia-specific and robustly expressed trans-membranous molecule, which is not expressed by other macrophages and immune or neuronal cells, and forms, therefore, the most promising microglia marker to date. TMEM119 has served as a reliable immunohistochemical microglia marker for neurodegenerative diseases since then and was recently stained by an adapted protocol for immunocytochemistry even in postmortem CSF samples of trauma cases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66500586971

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Robert Z Gatewood
Charlottesville, US
★★★★★ 3
It worked on all size of cans
Eh pretty good for the whopping 3 weeks I had it. Came home one day and it was broken. It still operated. As in all functions were there but it wouldn't latch onto cans anymore. I think one of my adult kids dropped it. Honestly surprised motor still operated after it's drop.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
F
Verified Purchase
FH
West Palm Beach, US
★★★★★ 1
Didn't work out for me after a few uses.
Broke after only like 5 uses...not worth the money. Doesn't stay sharp nor does it auto-clamp onto cans after such uses. Thought it worked only to find out it didn't cut the can and left little metal shavings from just kinda "scratching" the can and I ended up getting a splinter. Thought it was low on battery and fully charged only for it to keep not cutting the can. Trashed it just gonna buy a regular stand up from walmart or something.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2026
G
Verified Purchase
GardenGirl
Battle Creek, US
★★★★★ 5
So simple to use, I'm amazed
Color: Black
Wonderfully helpful. Description is accurate, shipping was quick. I saw a few poor comments, but I have none so far! The can opener has opened cans of several sizes, from tomato paste to large cans of tomatoes; soup cans to strangely shaped. It's opened 30 or so already without loss of power. It's a little noisy, but about equal to that of a stand up opener. It fits in my drawer, which is less deep than most kitchen drawers. Most of all, it's beyond easy to use for arthritic hands. The ONLY CHALLENGE I have is that it sometimes fails to stop when it should. MANUFACTURER: if you read this and have advice, please share. At this point, I'd say this is a great value for the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
S
Verified Purchase
SA
Waukegan, US
★★★★★ 5
Cordless can opener.
Color: Black
Works great and has been very reliable, open many cans on a single charge, would recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
K
Verified Purchase
karla deloatch
Grantham, US
★★★★★ 1
Pleased be careful
Color: Black
Please be very careful when using this. After using it 2 times it opened cans just fine. Then it stop opening cans and will make hair like strains of metals and one would think its hair and pull on it thus Cutting your fingers open. That’s what happened to me. Please be careful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026

recommand products