SKU: 68455990498

Human CXCL9/MIG, His tag

Sale price$105.75 Regular price$117.50
Save 10%

Pay in installments of $29.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CXCL9/MIG, His tagProduct Specification Species Human Synonyms Gamma interferon induced monokine, Monokine induced by interferon gamma (HuMIG; MIG), Small inducible cytokine B9, CMK, MIG, SCYB9 Accession Q07325 Amino Acid Sequence Protein sequence (Q07325, Thr23 Thr125, with C 10*His) TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 4 kDa

Product Specification


Species Human
Synonyms Gamma-interferon-induced monokine, Monokine induced by interferon-gamma (HuMIG; MIG), Small-inducible cytokine B9, CMK, MIG, SCYB9
Accession Q07325
Amino Acid Sequence

Protein sequence (Q07325, Thr23-Thr125, with C-10*His) TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.4 kDa Observed MW: 16, 17, 18 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as monokine induced by gamma interferon (MIG). The CXCL9 is one of the chemokine which plays role to induce chemotaxis, promote differentiation and multiplication of leukocytes, and cause tissue extravasation. The CXCL9/CXCR3 receptor regulates immune cell migration, differentiation, and activation. Immune reactivity occurs through recruitment of immune cells, such as cytotoxic lymphocytes (CTLs), natural killer (NK) cells, NKT cells, and macrophages. Th1 polarization also activates the immune cells in response to IFN-γ. Tumor-infiltrating lymphocytes are a key for clinical outcomes and prediction of the response to checkpoint inhibitors. In vivo studies suggest the axis plays a tumorigenic role by increasing tumor proliferation and metastasis. CXCL9 predominantly mediates lymphocytic infiltration to the focal sites and suppresses tumor growth. It is closely related to two other CXC chemokines called CXCL10 and CXCL11. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68455990498

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
Veller
Omaha, US
★★★★★ 5
Impressive
Scent: Lavender, Size: 32 Fl Oz (Pack of 1)
Very nice lavender scent. It smells like real lavender. It provides lasting moisture. Perfect after a bath.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
A
Verified Purchase
Alan
Birmingham, US
★★★★★ 5
Eczema
Puriya 5-in-1 Eczema Cream is worth every penny. While it may be priced slightly higher than some other creams, the quality and effectiveness make it a great value—especially since a little goes a long way! After trying countless products that either didn’t work or needed constant reapplication, this cream truly stands out for its long-lasting hydration and soothing effect. The scent is subtle and pleasant, which is perfect for sensitive skin. Unlike some lotions that have overpowering fragrances, this has a mild, natural aroma that doesn't linger or irritate. Most importantly, its effectiveness is unmatched! From the first use, the intense itching and irritation noticeably calmed down, and with regular application, I’ve seen a huge improvement in skin texture and hydration. It absorbs quickly, without feeling greasy, and provides relief for hours. Whether you're dealing with eczema, dry patches, or general skin discomfort, this cream delivers real results.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2025
J
Verified Purchase
Julie Moeser
Grantham, US
★★★★★ 5
It works very well.
I recommend this cream for eczema. I had several spots on my body so I would slather it on and with in 1 month the spots on my body were gone. BUT the spots on my scalp have not gone as it is hard to put this on your hair/ scalp every time it itches. So this has been an ongoing problem but it does soothe the skin that is flaring up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
R
Verified Purchase
Rikki M
Alexandria, US
★★★★★ 5
Best Cream!!
Love this stuff! I got this because menopause was killing my skin. It was awful! Itchy, red and dry. I couldn't sleep it was so bad. I found this, and it's literally the only thing that actually helped. I went through my first jar quickly, no you don't need much, but my rash was all over my arms, neck and chest. After my second jar and using it a few times a day, my rash is gone! Some people may not like the smell, but I think it's actually nice. It's not greasy, and I don't feel gross after putting it on. I hate greasy creams. On my third jar now! This one is lasting much longer since I don't need it as much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
A
Verified Purchase
AW
Lake Worth, US
★★★★★ 4
Good Relief, But a Little Pricey
I don’t usually write reviews, but I felt like this cream deserved one. I’ve tried so many products for dry, itchy eczema patches, and most either felt greasy, burned when applied, or just didn’t do much. Puriya has been such a refreshing change. The texture is smooth, it absorbs quickly without leaving that sticky feeling, and within a couple of days my skin felt calmer and the redness started to fade. What I really like is how versatile it is. I’ve used it on flare-ups, random dry spots, and even my hands when they get irritated in the summer. It feels gentle but still effective, and I don’t need to use a ton for it to work. The only reason I didn’t give it 5 stars is the price. It’s a little on the higher side for the amount you get. I also find myself reapplying a bit more often than I’d like. But overall, it’s one of the better creams I’ve tried, and I’ll definitely keep using it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 13, 2025

recommand products