SKU: 69269084483

Human ANGPT2 Protein, His tag

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ANGPT2 Protein, His tagProduct Specification Species Human Synonyms Angiopoietin 2, ANG 2 Accession O15123 Amino Acid Sequence Protein sequence (O15123, Asp68 Phe496, with C His tag)

Product Specification


Species Human
Synonyms Angiopoietin-2, ANG-2
Accession O15123
Amino Acid Sequence

Protein sequence (O15123, Asp68-Phe496, with C-His tag) DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Expression System HEK293
Molecular Weight

Predicted MW: 51 kDa Observed MW: 72 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Angiopoietin - 2 (ANGPT2) is a significant protein in the angiopoietin family. It plays a crucial role in angiogenesis, the process of new blood vessel formation. ANGPT2 is produced by endothelial cells and acts as a key regulator in vascular remodeling. Functionally, ANGPT2 binds to the Tie2 receptor on endothelial cells. In the presence of vascular endothelial growth factor (VEGF), ANGPT2 promotes endothelial cell destabilization, leading to increased vascular permeability and facilitating angiogenesis. However, in the absence of VEGF, it can cause vessel regression. Abnormal levels of ANGPT2 have been linked to various pathological conditions. In cancer, elevated ANGPT2 often correlates with tumor angiogenesis and metastasis, as tumors rely on new blood vessels for growth and spread. Additionally, it is involved in inflammatory diseases and eye disorders related to abnormal blood vessel growth, making it an important target for research into novel therapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69269084483

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Donald
Los Angeles, US
★★★★★ 5
"Durable Fun: Pweituoet Heavy Duty Squeaky Dog Balls for Aggressive Chewers"
Size: 4.5"
Product Review: The Pweituoet 4.5” Heavy Duty Squeaky Dog Balls have been a hit with my dog, proving to be both durable and entertaining. Durability: These dog balls are impressively tough. My dog is an aggressive chewer, and most toys don’t last long, but these balls have held up exceptionally well. The heavy-duty material and spiked design are perfect for dogs who love to chew, providing both durability and safety. Entertainment: The built-in squeaker adds an extra layer of fun. It captures my dog’s attention immediately, and the squeak keeps him engaged for longer play sessions. The spikes also make the ball easy for him to grip and carry around. Size: The 4.5” size is ideal for medium to large dogs. It’s large enough to avoid being a choking hazard but still easy for my dog to pick up and play with. The size and weight are just right for games of fetch, too. Value: Given the durability and how much my dog enjoys these balls, they offer great value for the price. They’ve lasted much longer than other toys we’ve tried, making them a worthwhile investment for any dog owner with a tough chewer. Overall Verdict: The Pweituoet Heavy Duty Squeaky Dog Balls are an excellent choice for medium to large dogs, especially those who are aggressive chewers. They’re durable, fun, and well-sized, making them a great addition to your dog’s toy collection. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 10, 2024
C
Verified Purchase
Chris Wells
Omaha, US
★★★★★ 5
Actually stands up to use
Size: 4.5", Size: 4.5"
I have a pitbull who is a toy destroyer. All those toys, even the ones that say tough enough for destroyers, never hold up. THESE BALLS ARE AWESOME! I bought the 2 pack of the 4.5 inch balls and they lasted a year. I literally am writing this review after ordering a new set. These are well worth the money and Ghost (my dog) loves them. Hes a 103lbs pitbull and his life mission is cuddles and destroying his toys... and these lasting a year of everyday use is friggin awesome. Both toys failed in the same way eventually. They gave out in a circle around the "squeker".
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 14, 2024
C
Verified Purchase
CFM
Boise, US
★★★★★ 3
Neutral
Size: 4.5"
She chewed it up in less than 10 minutes. This is not for heavy chewers but dogs that like to actually play with their toys it would be great!!! I gave it a 3 because it worked for my other dog who likes to play🤘
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026
M
Verified Purchase
Mitch
Whiting, US
★★★★★ 5
Our German Sheppard loves these
Size: Medium
These cost a bit more than tennis balls, but they are so much nicer and longer lasting. For starters, they stay cleaner than tennis balls because they’re smooth rubber. Dirt won’t build up on them and if anything does stick, like grass or soil, it falls off once the dog slobber dries. They’re also thick, so they don’t fall apart or blow out like a normal tennis ball does in our dog’s jaws after 30 seconds. Our GS chomps on these like crazy and the only damage they’ve suffered is a crack that developed from the edge of the hole, but the crack is growing very slowly and none of these balls have totally failed yet. The balls do whistle when thrown ant high speed and that may help a dog track and locate it, but I’m not sure. Our neighbors hear the whistling too so it’s far from silent. Lastly the orange ball is easy to locate out in our yard, but the dark blue practically disappears.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2025
C
Verified Purchase
Casey B
Boise, US
★★★★★ 5
Great for smaller dogs
Size: Small
These two balls are perfect for the smaller mouthed dog that loves to play fetch. These balls are not only super durable (lots of teeth biting), but float in the baby pool we use for our miniature dachshunds. The value here is much better than you’d find anywhere else. The noise, if bitten hard enough, was “low” at best. Easy to spot/find if overthrown. Will definitely buy again once these are in bad repair; so far, so good-love these for my fur babies!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 8, 2024

recommand products