Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 18 - Aug 23
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human C1q , His tagProduct Specification Species Human Synonyms Complement C1q subcomponent subunit A Accession P02745 Amino Acid Sequence Protein sequence(P02745, Glu23 Arg150, with C 10*His) EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 7kDa Actual: 20 25kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag
Product Specification
| Species | Human |
| Synonyms | Complement C1q subcomponent subunit A |
| Accession | P02745 |
| Amino Acid Sequence | Protein sequence(P02745, Glu23-Arg150, with C-10*His) EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:14.7kDa Actual:20-25kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
The complement component 1q (or simply C1q) is a protein complex involved in the complement system, which is part of the innate immune system. Antibodies of the adaptive immune system can bind antigen, forming an antigen-antibody complex. When C1q binds antigen-antibody complexes, the C1 complex becomes activated. Activation of the C1 complex initiates the classical complement pathway of the complement system. By virtue of its ability to bind to IgG and IgM containing immune complexes and activating the classical pathway, C1q acts as prototypical link between innate and adaptive immune wings of the immune system. The notion of C1q involvement in the pathogenesis of cancer is still evolving. C1q appears to have a dual role in cancer: tumor promoting as well as tumor-protective, depending on the context of the disease.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.2 ★★★★★
Based on 14 reviews
Sort
Product Reviews
★★★★★ 4
Solid Omegaverse!
Format: Kindle
4.5 strong stars!🌟
Overall great story solid omegaverse. I love how they’re fighting their instincts. Lots of spice, TONS of slick and heated moments.
**Slight spoiler sort of**
I was nervous reading this for pretty much one reason and that was the other “O” listed. I knew it wasn’t another female and I would have been happy/fine if it was but the concern lay in not knowing or being guaranteed the smexual preferences of our three alphas so realistically this gave me anxiety on how the dynamic would work. Anyone who has read omegaverse knows there’s usually one omega in each pack. My fear was the male omega connecting only with the female omega and that dynamic doesn’t wholly work for me. To me, the male omega needs the alphas as well so I was relieved with how this turned out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2025
★★★★★ 5
Good plot but definitely slow burn
Format: Kindle
⭐️⭐️⭐️⭐️.5|🌶️🌶️🌶️🌶️ (not a ton of spice scenes for an Omegaverse)
The plot, character development, scene progression, and action throughout the story was done really well. I did wish there was better pacing for the spice. I felt like the big spice was really rushed. During some scenes the story was a little hard to follow. I think some parts could’ve been cut. Overall I would read more from this author! 💖
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2025
★★★★★ 5
omg loved the story
Format: Kindle
I’ve been in a reading slump DNFing so many books and finally found a story to keep me captivated… now with that though there were still some parts that were a bit of a struggle like Tatums struggle with the past trauma she dragged that on for ever I get it pasts are hard to overcome sometimes. But honestly it was easy to get over it falling in love with all these little psychos 🤣🤣🤣 absolutely loved Kodi’s obsession with getting Easton even though he doesn’t know him but smells brownies everywhere and missing the mark it was hysterical.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2025
★★★★★ 4
Omegaverse with rival families.
Format: Kindle
Tatum is trying to raise enough money to treat her omega mother who has fallen catatonic due to the death of her mate. To make the money she needs she agrees to work at a gentleman's club scantily dressed. There she meets the twin Hayes brothers, Declan and Kodiak, what she doesn't know is that their younger half brother is the high school sweetheart that ghosted her after helping with her first heat. Tatum also meets Easton, the mysterious male omega that pops into her life but she finds herself strongly attracted to.
I enjoyed all the characters, even those that were not major characters, the plot was good, the storyline was well done. I would recommend this book if you liked Omegaverse stories, mafia storylines, and good romance with why choose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2025
★★★★★ 5
Loved it!
Format: Kindle
Who doesn’t love morally grey men obsessed with their omega who isn’t afraid to call them out on their unacceptable behavior and make them grovel?
Tatum really is a survivor through and through. She is willing to do anything to get her mother the help she needs, even deal with the man her broke her heart.
If you love brothers playing jokes, crazy stabby omegas and rich men being told no, you will enjoy this book. Great spice and great ending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2025
recommand products
Torn Afghanistan Flag Afghan Day Football Mens Ringer T-Shirt FotL
10.49
Curled Mexico Flag Mexican Day Football Kids Sweatshirt Jumper
12.50
Curled Fiji Flag Fijian Day Football Childrens Kids Hoodie
13.99
Curled Palestine Flag Palestinian Day Football Mens 80% Cotton Hoodie
20.99
Curled Solomon Islands Flag Day Football Childrens Kids Hoodie
13.99