Pay in installments of $112.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
HRP-Labeled ATG4B His Tag Protein, HumanProduct Specification Species Human Synonyms ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353 Accession Q9Y4P1 Amino Acid Sequence Met1 Leu393, with N terminal 8*His
Product Specification
| Species | Human |
| Synonyms | ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353 |
| Accession | Q9Y4P1 |
| Amino Acid Sequence | Met1-Leu393, with N-terminal 8*His HHHHHHHHMDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL |
| Expression System | E.coli |
| Molecular Weight | 45kDa |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | HRP |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Zheng X. et al. (2020) The protease activity of human ATG4B is regulated by reversible oxidative modification. Autophagy. 16(10): 1838-1850. |
Background
Initiation and development of autophagy is modulated by several autophagy-related (ATG) genes, which have been identified in yeast and human. Autophagy begins with the formation and maturation of the double-membraned autophagosomes which engulf and deliver cargoes to lysosomes for degradation. The assembling process of autophagosomes is mediated by a family of core ATG proteins, including two ubiquitin-like systems. First, inactive precursor MAP1LC3/LC3 is cleaved by protease ATG4B at the conserved C-terminal glycine residue. After a set of transfer and activation by ATG7, ATG3 and ATG12-ATG5-ATG16L1, the processed LC3 (LC3-I) finally conjugates with phosphatidylethanolamine (PE) at the exposed glycine site via a covalent bond. So far, lipidated LC3, called LC3-II, has become a biomarker of autophagy because of its characteristic of anchoring into the autophagosome membrane. Upon fusion with lysosomes, ATG4B can, in turn, deconjugate LC3-PE to release LC3-I to the cytoplasm for reuse. Hence, ATG4B serves as a priming and delipidation enzyme whose fine regulation is essential for autophagy process.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 5 reviews
Sort
Product Reviews
★★★★★ 5
Very sturdy chew toy
Color: Bacon
My Frenchy loves it! He’s not a large dog, but big for a French Bulldog. (32 lbs). He chews both ends, but prefers the snout. The eyes are cute, but began to peel off within the first week. I easily removed what was peeling. Half of the paint remained intact. When necessary, I will definitely replace it with the same toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
★★★★★ 5
Great chew toy, long lasting
Color: Bacon
This chew toy has been amazing. We have had it for 2 months with 2 dogs chewy on it and it is still going strong. We have a large Golden who chews on everything and and German Shepherd. Big dogs who chew aggressively. Very impressed! Would definitely buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
★★★★★ 5
Buy it!
Color: Bacon, Color: Bacon
They love it! Very durable and a great squeaker that is seemingly indestructible! Definitely getting it in other colors, and impressed at the quality for the price. Don’t hesitate on this one- corgi and dachshund approved!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
★★★★★ 5
Perfect for young pups who get bored easily!
Color: Bacon, Color: Bacon
Our pup recently turned 1 and gets bored very easily, so she’s always looking for something new to chew or play with. We got her this little alligator toy and she is OBSESSED with it! She carries it everywhere and plays with it constantly. I’m honestly surprised by how durable it’s been considering how much use it gets. If you want to help save your furniture and household items from becoming chew toys, do yourself a favor and grab this for your pup!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
★★★★★ 4
Extremely durable but too large for our Aussie
Color: Bacon -Blue
This toy is very solid and seems like it would hold up well for aggressive chewers, but it ended up being too large and heavy for our Australian Shepherd. He had trouble comfortably holding it in his mouth and wasn’t very interested in chewing on it because of the size and weight.
The quality itself seems good, but I would recommend it more for larger dogs with bigger jaws that enjoy heavier chew toys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026